Human CellExp Cathepsin S, human recombinant protein
Cathepsin S, CTSS
- SPECIFICATION
- CITATIONS
- PROTOCOLS
- BACKGROUND
Primary Accession | P25774 |
---|---|
Concentration | 0.2 µM |
Calculated MW | ~ 37 kDa |
Gene ID | 1520 |
---|---|
Gene Symbol | CTSS |
Other Names | Cathepsin S, CTSS |
Gene Source | Human |
Source | HEK 293 cells |
Assay&Purity | SDS-PAGE; ≥95% |
Assay2&Purity2 | SEC-HPLC; ≥95% |
Recombinant | Yes |
Results | >1000 mU (1U = 1 µmole/min/mg) . |
Sequence | QLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNWILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEIVDHHHHHH |
Target/Specificity | Cathepsin S |
Format | Liquid |
Storage | -80°C; A 0.2 µM filtered solution of 20mM MES, 150mM NaCl, 10% Glycerol, pH 5.5. |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
info@abcepta.com, and receive a free "I Love Antibodies" mug.
Provided below are standard protocols that you may find useful for product applications.
Background
Cathepsin S (CTSS) is a lysosomal cysteine protease of the papain family and may participate in the degradation of antigenic proteins to peptides for presentation on MHC class II molecules. CTSS is synthesized as inactive precursor of 331 amino acids consisting of a 15-aa signal peptide, a propeptide of 99 aa, and a mature polypeptide of 217 aa. It is activated in the lysosomes by a proteolytic cleavage of the propeptide. The deduced amino acid sequence contains only one potential N-glycosylation site located in the propeptide. Compared with the abundant cathepsins B, L and H, cathepsin S shows a restricted tissue distribution, with highest levels in spleen, heart, and lung. In addition, evidences indicated that cathepsin S generates A beta from amyloidogenic fragments of beta APP in the endosomal/lysosomal compartment, and is implicated in the pathogenesis of Alzheimer’s disease (AD) and Down Syndrome (DS).
References
Shi G.-P.,et al.J. Biol. Chem. 267:7258-7262(1992).
Wiederanders B.,et al.J. Biol. Chem. 267:13708-13713(1992).
Wiederanders B.,et al.Submitted (MAY-1995) to the EMBL/GenBank/DDBJ databases.
Shi G.-P.,et al.J. Biol. Chem. 269:11530-11536(1994).
Ebert L.,et al.Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases.
If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abcepta.com.