Neuropeptide W-30 (human)
Synthetic Peptide
- SPECIFICATION
- CITATIONS
- PROTOCOLS
- BACKGROUND
Primary Accession | Q8N729 |
---|---|
Sequence | WYKHVASPRYHTVGRAAGLLMGLRRSPYLW |
Gene ID | 283869 |
---|---|
Other Names | Neuropeptide W, Preproprotein L8, hPPL8, Neuropeptide W-23, NPW23, hL8, Neuropeptide W-30, NPW30, hL8C, NPW, PPL8, PPNPW |
Format | Peptides are lyophilized in a solid powder format. Peptides can be reconstituted in solution using the appropriate buffer as needed. |
Storage | Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C. |
Precautions | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Name | NPW |
---|---|
Synonyms | PPL8, PPNPW |
Function | Plays a regulatory role in the organization of neuroendocrine signals accessing the anterior pituitary gland. Stimulates water drinking and food intake. May play a role in the hypothalamic response to stress (By similarity). NPW23 activates GPR7 and GPR8 more efficiently than NPW30. |
Cellular Location | Secreted |
Tissue Location | Detected in cerebrospinal fluid and urine (at protein level) (PubMed:25326458, PubMed:36213313, PubMed:37453717) Detected at high levels in the substantia nigra, fetal kidney and trachea; at lower levels in testis, uterus, ovary and placenta. Not detectable in many regions of the central nervous system. Also detected at high levels in lymphoblastic leukemia and colorectal adenocarcinoma |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
info@abcepta.com, and receive a free "I Love Antibodies" mug.
Provided below are standard protocols that you may find useful for product applications.
If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abcepta.com.