---All---
  • ---All---
  • Accession
  • Catalog #

Des His1, Glu8 Exendin-4Synthetic Peptide

Country
United States
Australia Austria Belgium Brazil Bulgaria Canada China Croatia Cyprus Czech Republic Denmark Estonia Finland France Germany Greece Hungary Iceland India Indonesia Ireland Israel Italy Japan Korea Latvia Lithuania Luxembourg Macedonia Malaysia Malta Netherlands Norway Pakistan Poland Portugal Romania Serbia Singapore Slovakia Slovenia Spain Sweden Switzerland Taiwan Turkey United Kingdom United States Vietnam Others
Ordering Information
Catalog # Size Availability Price  
SP2708b 1 mg 400 ul In Stock $ 238.00 Add to cart
  • Specification
  • Citiations : 0
  • Reviews
  • Protocols
  • Backgrounds

Des His1, Glu8 Exendin-4 - Product info

Calculated MW4063.47 Da
SequenceNH2-GEGTFTSELSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-CONH2

Des His1, Glu8 Exendin-4 - Additional info

Format
Peptides are lyophilized in a solid powder format. Peptides can be reconstituted in solution using the appropriate buffer as needed.
Storage
Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.
Precautions
This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the
"Submit Review" button and provide the requested information. Our staff will examine and post your
review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abgent.com.

Thank you for your support.


Submit

Provided below are standard protocols that you may find useful for product applications.