- Antibodies
- New
- Biological Process >
- Cellular Compartment >
- Disease >
- Molecular Function >
- Pathway Biocarta >
- Pathway KEGG >
- Pathway Panther >
- Tissue >
- Tag
- Peptides
- Biological Process >
- Cellular Compartment >
- Disease >
- Molecular Function >
- Pathway Biocarta >
- Pathway KEGG >
- Pathway Panther >
- Tissue >
- Amino Acids
- Tag
- Biological Process >
- Proteins
- RNAi
- FL cDNA Clones
- Cell/Tissues/Lysates
Des His1, Glu8 Exendin-4Synthetic Peptide
| Country | United States
Ordering Information
|
|||
|---|---|---|---|---|
| Catalog # | Size | Availability | Price | |
| SP2708b | 1 mg 400 ul | In Stock | $ 238.00 | DISCONTINED INQUIRE CLICK INQUIRE Add to cart |
- Specification
- Citiations : 0
- Reviews
- Protocols
- Backgrounds
Des His1, Glu8 Exendin-4 - Product info | |
| Calculated MW | 4063.47 Da |
| Sequence | NH2-GEGTFTSELSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-CONH2 |
Des His1, Glu8 Exendin-4 - Additional info | |
| Format Peptides are lyophilized in a solid powder format. Peptides can be reconstituted in solution using the appropriate buffer as needed. | |
| Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C. | |
| Precautions This product is for research use only. Not for use in diagnostic or therapeutic procedures. | |
Abgent welcomes feedback from its customers.
If you have used an Abgent product and would like to share how it has performed, please click on the
"Submit Review" button and provide the requested information. Our staff will examine and post your
review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abgent.com.
Thank you for your support.
Provided below are standard protocols that you may find useful for product applications.