Register or Login
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Peptides   >   Synthetic Peptides   >   Prolactin-Releasing Peptide (1-31), rat   

Prolactin-Releasing Peptide (1-31), rat

Synthetic Peptide

Product Information
Primary Accession P81278
Calculated MW 3594 Da
Additional Information
Other Names Prolactin-releasing peptide, PrRP, Prolactin-releasing hormone, Prolactin-releasing peptide PrRP31, Prolactin-releasing peptide PrRP20, Prlh, Prh
Format Peptides are lyophilized in a solid powder format. Peptides can be reconstituted in solution using the appropriate buffer as needed.
StorageMaintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.
PrecautionsThis product is for research use only. Not for use in diagnostic or therapeutic procedures.
Protein Information
Name Prlh
Synonyms Prh
Function Stimulates prolactin (PRL) release and regulates the expression of prolactin through its receptor GPR10. May stimulate lactotrophs directly to secrete PRL.
Cellular Location Secreted.
Tissue Location Widely expressed, with highest levels in medulla oblongata and hypothalamus. EMBL; AB015418; BAA29026.1; -; mRNA EMBL; AB040613; BAB33377.1; -; Genomic_DNA EMBL; AF521930; AAM82154.1; -; mRNA PIR; JC7607; JC7607 RefSeq; NP_071558.1; NM_022222.1. [P81278-1] RefSeq; XP_006245540.1; XM_006245478.3. [P81278-1] UniGene; Rn.91303; - PaxDb; P81278; - PRIDE; P81278; - Ensembl; ENSRNOT00000026912; ENSRNOP00000026912; ENSRNOG00000019871. [P81278-1] GeneID; 63850; - KEGG; rno:63850; - UCSC; RGD:628634; rat. [P81278-1] CTD; 51052; - RGD; 628634; Prlh eggNOG; ENOG410J49T; Eukaryota eggNOG; ENOG4111800; LUCA GeneTree; ENSGT00390000005489; - HOGENOM; HOG000115720; - HOVERGEN; HBG004601; - InParanoid; P81278; - KO; K05269; - OMA; TRTPDIN; - OrthoDB; EOG091G191K; - PhylomeDB; P81278; - Reactome; R-RNO-375276; Peptide ligand-binding receptors PRO; PR:P81278; - Proteomes; UP000002494; Chromosome 9 Bgee; ENSRNOG00000019871; - Genevisible; P81278; RN GO; GO:0005737; C:cytoplasm; IDA:MGI GO; GO:0005576; C:extracellular region; IEA:UniProtKB-SubCell GO; GO:0005179; F:hormone activity; TAS:RGD GO; GO:0005184; F:neuropeptide hormone activity; IMP:RGD GO; GO:0005148; F:prolactin receptor binding; TAS:RGD GO; GO:0031861; F:prolactin-releasing peptide receptor binding; IMP:RGD GO; GO:0048483; P:autonomic nervous system development; IEA:Ensembl GO; GO:0006112; P:energy reserve metabolic process; IEA:Ensembl GO; GO:0045444; P:fat cell differentiation; IEA:Ensembl GO; GO:0007631; P:feeding behavior; IMP:RGD GO; GO:0007186; P:G-protein coupled receptor signaling pathway; IMP:RGD GO; GO:0006629; P:lipid metabolic process; IEA:Ensembl GO; GO:0002023; P:reduction of food intake in response to dietary excess; IMP:MGI GO; GO:0040014; P:regulation of multicellular organism growth; IEA:Ensembl GO; GO:0009749; P:response to glucose; IEA:Ensembl GO; GO:0032868; P:response to insulin; IEA:Ensembl GO; GO:0001894; P:tissue homeostasis; IEA:Ensembl InterPro; IPR026194; PrRP PANTHER; PTHR17206; PTHR17206; 1 Pfam; PF15172; Prolactin_RP; 1 2: Evidence at transcript level; Alternative splicing; Amidation; Cleavage on pair of basic residues; Complete proteome; Hormone; Reference proteome; Secreted; Signal SIGNAL 1 21 PEPTIDE 22 52 Prolactin-releasing peptide PrRP31 /FTId=PRO_0000022147 PEPTIDE 33 52 Prolactin-releasing peptide PrRP20 /FTId=PRO_0000022148 PROPEP 57 83 /FTId=PRO_0000022149 MOD_RES 52 52 Phenylalanine amide. VAR_SEQ 33 83 TPDINPAWYTGRGIRPVGRFGRRRATPRDVTGLGQLSCLPL DGRTKFSQRG -> SECLTYGKQPLTSFHPFTSQMPP (in isoform 2). /FTId=VSP_004370 SEQUENCE 83 AA; 9215 MW; D0C75A264EEE4F29 CRC64; MALKTWLLCL LLLSLVLPGA SSRAHQHSME TRTPDINPAW YTGRGIRPVG RFGRRRATPR DVTGLGQLSC LPLDGRTKFS QRG
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to, and receive a free "I Love Antibodies" mug.
Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at

Cat# SP3147a
Availability: Inquire
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanKoreaLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Buy Antibody, Get One  Selected Loading Control Free.
30% off on 400+ Stem Cells Antibodies. PromoCode: <span class=text-red>FLASH19</span>
Terms & Conditions