Biotin-PACAP (1-38), amide, human, ovine, rat
Synthetic Peptide
- SPECIFICATION
- CITATIONS
- PROTOCOLS
- BACKGROUND
Primary Accession | O70176 |
---|---|
Other Accession | P13589, Q29W19, P16613, P18509, P41535 |
Sequence | BIOTIN-HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-CONH2 |
Gene ID | 11516 |
---|---|
Other Names | Pituitary adenylate cyclase-activating polypeptide, PACAP, PACAP-related peptide, PRP-48, Pituitary adenylate cyclase-activating polypeptide 27, PACAP-27, PACAP27, Pituitary adenylate cyclase-activating polypeptide 38, PACAP-38, PACAP38, Adcyap1, Pacap |
Format | Peptides are lyophilized in a solid powder format. Peptides can be reconstituted in solution using the appropriate buffer as needed. |
Storage | Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C. |
Precautions | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Name | Adcyap1 |
---|---|
Synonyms | Pacap |
Function | Binding to its receptor activates G proteins and stimulates adenylate cyclase in pituitary cells (By similarity). Promotes neuron projection development through the RAPGEF2/Rap1/B-Raf/ERK pathway (By similarity). In chromaffin cells, induces long-lasting increase of intracellular calcium concentrations and neuroendocrine secretion (By similarity). Involved in the control of glucose homeostasis, induces insulin secretion by pancreatic beta cells (PubMed:23913443). |
Cellular Location | Secreted. |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
info@abcepta.com, and receive a free "I Love Antibodies" mug.
Provided below are standard protocols that you may find useful for product applications.
If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abcepta.com.