Register or Login
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Stem Cells   >   Anti Human GDF9 Antibody, clone mAb-GDF9-53    

Anti Human GDF9 Antibody, clone mAb-GDF9-53

Mouse Anti-Human Monoclonal Antibody

  • WB - Anti Human GDF9 Antibody, clone mAb-GDF9-53  ABD12691
    GDF9 over expressing lysate probed with Mouse anti Human GDF9
Product Information
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
WB, IHC-P, IHC-F, Func
Primary Accession Q07105
Other Accession O60383, O77681
Reactivity Human
Host Mouse
Clonality Monoclonal
Isotype IgG
Clone Names mAb-GDF9-53
Calculated MW 49649 Da
Additional Information
Other Species M,Sh
Purification Purified IgG prepared by affinity chromatography on Protein G
Immunogen Tuberculin coupled synthetic peptide VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC from near the C-terminal region of mature human GDF9.
Shelf Life 18 months from date of despatch.
Gene ID 14566
Other Names Growth/differentiation factor 9, GDF-9, Gdf9, Gdf-9
Target/Specificity Mouse anti Human GDF9 antibody, clone mAb-GDF9-53 recognizes an epitope within the highly conserved EPDG sequence of GDF9 (growth differentiation factor 9), a 454 amino acid ~51 kDa pro-protein which is cleaved to form a ~17.5 kDa GDF9 monomer which self associates to form an active homodimeric growth factor, a member of the TGF-beta superfamily, closely related to bone morphogenetic proteins (BMPs).GDF9 is expressed by oocytes, playing a vital role in ovarian folliculogenesis, normal follicle development, and fertility. GDF9 signals through binding to bone morphogenetic protein type II receptor (BMPRII), and apparent subsequent activation of TGF-beta type I receptor, otherwise known as activin receptor-like kinase-5 (ALK-5).Mouse anti Human GDF9 antibody, clone mAb-GDF9-53 recognises GDF9 with high immuno-affinity, and has been shown to neutralize GDF9 biological activity (Gilchristet al.2004,Dragovic et al. 2005).Removal of sodium azide is recommended prior to use in functional assays – AbD Serotec recommend the use of EQU003 for this purpose.
Preservative & Stabilisers 0.09% Sodium Azide (NaN3)
Storage Store at +4℃ or at -20℃ if preferred.
PrecautionsAnti Human GDF9 Antibody, clone mAb-GDF9-53 is for research use only and not for use in diagnostic or therapeutic procedures.
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to, and receive a free "I Love Antibodies" mug.
Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at

Cat# ABD12691
Availability: Inquire
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions