Register or Login
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Signal Transduction   >   Anti-MMP11 Picoband Antibody   

Anti-MMP11 Picoband Antibody

  • WB - Anti-MMP11 Picoband Antibody ABO10308
    Western blot analysis of MMP11 expression in rat spleen extract (lane 1) and MM231 whole cell lysates (lane 2). MMP11 at 55KD was detected using rabbit anti- MMP11 Antigen Affinity purified polyclonal antibody (Catalog #ABO10308) at 0.5 μg/mL. The blot was developed using chemiluminescence (ECL) method .
  • IHC - Anti-MMP11 Picoband Antibody ABO10308
    MMP11 was detected in paraffin-embedded sections of mouse spleen tissues using rabbit anti- MMP11 Antigen Affinity purified polyclonal antibody (Catalog # ABO10308) at 1 μg/mL. The immunohistochemical section was developed using SABC method .
  • IHC - Anti-MMP11 Picoband Antibody ABO10308
    MMP11 was detected in paraffin-embedded sections of rat spleen tissues using rabbit anti- MMP11 Antigen Affinity purified polyclonal antibody (Catalog # ABO10308) at 1 μg/mL. The immunohistochemical section was developed using SABC method .
  • IHC - Anti-MMP11 Picoband Antibody ABO10308
    MMP11 was detected in paraffin-embedded sections of human appendicitis tissues using rabbit anti- MMP11 Antigen Affinity purified polyclonal antibody (Catalog # ABO10308) at 1 μg/mL. The immunohistochemical section was developed using SABC method .
Product Information
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
Primary Accession P24347
Host Rabbit
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Format Lyophilized
Description Rabbit IgG polyclonal antibody for Stromelysin-3(MMP11) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Additional Information
Gene ID 4320
Other Names Stromelysin-3, SL-3, ST3, 3.4.24.-, Matrix metalloproteinase-11, MMP-11, MMP11, STMY3
Calculated MW 54590 MW KDa
Application Details Immunohistochemistry(Paraffin-embedded Section), 0.5-1 µg/ml, Human, Mouse, Rat, By Heat

Western blot, 0.1-0.5 µg/ml, Human, Rat
Subcellular Localization Secreted, extracellular space, extracellular matrix .
Tissue Specificity Specifically expressed in stromal cells of breast carcinomas.
Protein Name Stromelysin-3
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human MMP11 (104-135aa RWEKTDLTYRILRFPWQLVQEQVRQTMAEALK), different from the related mouse and rat sequences by three amino acids.
Purification Immunogen affinity purified.
Cross Reactivity No cross reactivity with other proteins
Storage At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Information
Name MMP11
Synonyms STMY3
Function May play an important role in the progression of epithelial malignancies.
Cellular Location Secreted, extracellular space, extracellular matrix
Tissue Location Specifically expressed in stromal cells of breast carcinomas
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to, and receive a free "I Love Antibodies" mug.


Stromelysin-3 (SL-3) also known as matrix metalloproteinase-11 (MMP-11) is an enzyme that in humans is encoded by the MMP11 gene. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. However, the enzyme encoded by this gene is activated intracellularly by furin within the constitutive secretory pathway. Also in contrast to other MMP's, this enzyme cleaves alpha 1-proteinase inhibitor but weakly degrades structural proteins of the extracellular matrix.

Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at

$ 280.00
Cat# ABO10308
Availability: 3-5 days
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions