Register or Login
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Signal Transduction   >   Anti-SLC12A1 Picoband Antibody   

Anti-SLC12A1 Picoband Antibody

  • WB - Anti-SLC12A1 Picoband Antibody ABO12083
    Anti- SLC12A1 Picoband antibody, ABO12083, Western blottingAll lanes: Anti SLC12A1 (ABO12083) at 0.5ug/mlLane 1: HELA Whole Cell Lysate at 40ugLane 2: JURKAT Whole Cell Lysate at 40ugLane 3: SKOV Whole Cell Lysate at 40ugLane 4: Mouse Kidney Tissue Lysate at 50ugPredicted bind size: 121KDObserved bind size: 121KD
  • IHC - Anti-SLC12A1 Picoband Antibody ABO12083
    Anti- SLC12A1 Picoband antibody, ABO12083, IHC(P)IHC(P): Mouse Kidney Tissue
  • IHC - Anti-SLC12A1 Picoband Antibody ABO12083
    Anti- SLC12A1 Picoband antibody, ABO12083, IHC(P)IHC(P): Rat Kidney Tissue
  • IHC - Anti-SLC12A1 Picoband Antibody ABO12083
    Anti- SLC12A1 Picoband antibody, ABO12083, IHC(P)IHC(P): Human Kidney Cancer Tissue
Product Information
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
Primary Accession Q13621
Host Rabbit
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Format Lyophilized
Description Rabbit IgG polyclonal antibody for Solute carrier family 12 member 1(SLC12A1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Additional Information
Gene ID 6557
Other Names Solute carrier family 12 member 1, Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 2, Kidney-specific Na-K-Cl symporter, SLC12A1, NKCC2
Calculated MW 121450 MW KDa
Application Details Immunohistochemistry(Paraffin-embedded Section), 0.5-1 µg/ml, Human, Mouse, Rat, By Heat
Western blot, 0.1-0.5 µg/ml, Human, Mouse
Subcellular Localization Membrane; Multi-pass membrane protein.
Tissue Specificity Kidney specific.
Protein Name Solute carrier family 12 member 1
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human SLC12A1(52-83aa DEAQKRLRISFRPGNQECYDNFLQSGETAKTD), different from the related mouse sequence by two amino acids, and from the related rat sequence by four amino acids.
Purification Immunogen affinity purified.
Cross Reactivity No cross reactivity with other proteins.
Storage At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Information
Name SLC12A1
Synonyms NKCC2
Function Electrically silent transporter system. Mediates sodium and chloride reabsorption. Plays a vital role in the regulation of ionic balance and cell volume.
Cellular Location Membrane; Multi-pass membrane protein.
Tissue Location Kidney specific.
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to, and receive a free "I Love Antibodies" mug.


Solute carrier family 12 (sodium/potassium/chloride transporters), member 1, also called NKCC2 is specifically found in cells of the thick ascending limb of the loop of Henle in nephrons, the basic functional units of the kidney. This gene is mapped to 15q21.1. This gene encodes a kidney-specific sodium-potassium-chloride cotransporter that is expressed on the luminal membrane of renal epithelial cells of the thick ascending limb of Henle's loop and the macula densa. It plays a key role in concentrating urine and accounts for most of the NaCl resorption. It is sensitive to such diuretics as furosemide and bumetanide. Some Bartter-like syndromes result from defects in this gene. This gene plays a vital role in the regulation of ionic balance and cell volume.

Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at

$ 280.00
Cat# ABO12083
Availability: 3-5 days
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions