Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Signal Transduction   >   Anti-FMO3 Picoband Antibody   

Anti-FMO3 Picoband Antibody

     
  • WB - Anti-FMO3 Picoband Antibody ABO12276
    Anti- FMO3 Picoband antibody, ABO12276, Western blottingAll lanes: Anti FMO3 (ABO12276) at 0.5ug/mlLane 1: Rat Liver Tissue Lysate at 50ugLane 2: Mouse Liver Tissue Lysate at 50ugLane 3: SMMC Whole Cell Lysate at 40ugPredicted bind size: 60KDObserved bind size: 60KD
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
WB
Primary Accession P31513
Host Rabbit
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Format Lyophilized
Description Rabbit IgG polyclonal antibody for Dimethylaniline monooxygenase [N-oxide-forming] 3(FMO3) detection. Tested with WB in Human;Mouse;Rat.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Additional Information
Gene ID 2328
Other Names Dimethylaniline monooxygenase [N-oxide-forming] 3, 1.14.13.8, Dimethylaniline oxidase 3, FMO II, FMO form 2, Hepatic flavin-containing monooxygenase 3, FMO 3, Trimethylamine monooxygenase, 1.14.13.148, FMO3
Calculated MW 60033 MW KDa
Application Details Western blot, 0.1-0.5 µg/ml, Human, Mouse, Rat
Subcellular Localization Microsome membrane. Endoplasmic reticulum membrane.
Tissue Specificity Liver.
Protein Name Dimethylaniline monooxygenase [N-oxide-forming] 3
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human FMO3 (404-433aa DMMNDINEKMEKKRKWFGKSETIQTDYIVY), different from the related mouse sequence by eight amino acids, and from the related rat sequence by six amino acids.
Purification Immunogen affinity purified.
Cross Reactivity No cross reactivity with other proteins
Storage At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Sequence Similarities Belongs to the FMO family.
Protein Information
Name FMO3
Function Essential hepatic enzyme that catalyzes the oxygenation of a wide variety of nitrogen- and sulfur-containing compounds including drugs as well as dietary compounds (PubMed:10759686, PubMed:30381441). Plays an important role in the metabolism of trimethylamine (TMA), via the production of trimethylamine N-oxide (TMAO) metabolite (PubMed:9776311). TMA is generated by the action of gut microbiota using dietary precursors such as choline, choline containing compounds, betaine or L-carnitine. By regulating TMAO concentration, FMO3 directly impacts both platelet responsiveness and rate of thrombus formation (PubMed:29981269).
Cellular Location Microsome membrane {ECO:0000250|UniProtKB:P32417}; Single-pass membrane protein. Endoplasmic reticulum membrane {ECO:0000250|UniProtKB:P32417}; Single-pass membrane protein
Tissue Location Liver.
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to
info@abgent.com, and receive a free "I Love Antibodies" mug.

Background

FMO3 (Flavin-containing Monooxygenase 3) is an enzyme that in humans is encoded by the FMO3 gene. The mammalian flavin-containing monooxygenases (FMO) represent a multigene family whose gene products are localized in the endoplasmic reticulum of many tissues. The FMO3 gene contains 1 noncoding and 8 coding exons. And the FMO3 gene is mapped on 1q24.3. Using quantitative RNase protection assays, FMO3 is present in low abundance in fetal liver and lung and in adult kidney and lung, and in much greater abundance in adult liver. By Western blot analysis of human liver microsomal samples ranging from 8 weeks gestation to 18 years of age, FMO1 is the major fetal isoform and FMO3 is the major adult isoform. FMO3 was expressed at intermediate levels until 11 years of age when a gender-independent increase in FMO3 expression was observed during puberty. Sufferers of trimethylaminuria may display a reduced ability to metabolize substrates for FMO3 such as nicotine. FMO3 metabolizes a number of drugs, including amphetamine, clozapine, deprenyl, metamphetamine, tamoxifen, ethionamide, thiacetazone, and sulindac sulfide.

FeedBack
Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abgent.com.

$ 240.00
Cat# ABO12276
Size:
Quantity:
Availability: 3-5 days
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions
"