Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Anti-IGFBP-1 Antibody   

Anti-IGFBP-1 Antibody

     
  • WB - Anti-IGFBP-1 Antibody ABO12290
    Anti- IGFBP-1 Picoband antibody, ABO12290, Western blottingAll lanes: Anti IGFBP-1 (ABO12290) at 0.5ug/mlLane 1: Rat Kidney Tissue Lysate at 50ugLane 2: Mouse Kidney Tissue Lysate at 50ugPredicted bind size: 28KDObserved bind size: 28KD
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
WB, E
Primary Accession P47876
Host Rabbit
Reactivity Mouse, Rat
Clonality Polyclonal
Format Lyophilized
Description Rabbit IgG polyclonal antibody for Insulin-like growth factor-binding protein 1(IGFBP1) detection. Tested with WB, ELISA in Mouse;Rat.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Additional Information
Other Names Insulin-like growth factor-binding protein 1, IBP-1, IGF-binding protein 1, IGFBP-1, Igfbp1, Igfbp-1
Calculated MW 29570 MW KDa
Application Details ELISA , 0.1-0.5 µg/ml, Mouse, -
Western blot, 0.1-0.5 µg/ml, Mouse, Rat
Subcellular Localization Secreted.
Protein Name Insulin-like growth factor-binding protein 1
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of mouse IGFBP-1 (177-207aa REIADLKKWKEPCQRELYKVLERLAAAQQKA), different from the related human sequence by eleven amino acids, and from the related rat sequence by one amino acid.
Purification Immunogen affinity purified.
Cross Reactivity No cross reactivity with other proteins
Storage At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Sequence Similarities Contains 1 IGFBP N-terminal domain.
Protein Information
Name Igfbp1
Synonyms Igfbp-1
Function IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Promotes cell migration (By similarity).
Cellular Location Secreted. EMBL; X81579; CAA57269.1; -; mRNA EMBL; AL607124; CAI24501.1; -; Genomic_DNA EMBL; CH466574; EDL40608.1; -; Genomic_DNA EMBL; X67493; CAA47832.1; -; Genomic_DNA CCDS; CCDS24427.1; - PIR; I48600; I48600 PIR; S25113; S25113 RefSeq; NP_032367.3; NM_008341.4 UniGene; Mm.21300; - ProteinModelPortal; P47876; - SMR; P47876; - DIP; DIP-60631N; - IntAct; P47876; 2 STRING; 10090.ENSMUSP00000020704; - MEROPS; I31.951; - iPTMnet; P47876; - PhosphoSitePlus; P47876; - PaxDb; P47876; - PeptideAtlas; P47876; - PRIDE; P47876; - Ensembl; ENSMUST00000020704; ENSMUSP00000020704; ENSMUSG00000020429 GeneID; 16006; - KEGG; mmu:16006; - UCSC; uc007hzh.2; mouse CTD; 3484; - MGI; MGI:96436; Igfbp1 eggNOG; ENOG410IITJ; Eukaryota eggNOG; ENOG4111H9A; LUCA GeneTree; ENSGT00940000157394; - HOGENOM; HOG000253012; - HOVERGEN; HBG002631; - InParanoid; P47876; - OMA; WCVYPWS; - OrthoDB; 979270at2759; - TreeFam; TF331211; - Reactome; R-MMU-381426; Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) Reactome; R-MMU-8957275; Post-translational protein phosphorylation PRO; PR:P47876; - Proteomes; UP000000589; Chromosome 11 Bgee; ENSMUSG00000020429; Expressed in 59 organ(s), highest expression level in liver Genevisible; P47876; MM GO; GO:0005615; C:extracellular space; IDA:MGI GO; GO:0005794; C:Golgi apparatus; ISO:MGI GO; GO:0005520; F:insulin-like growth factor binding; IPI:MGI GO; GO:0031994; F:insulin-like growth factor I binding; ISO:MGI GO; GO:0031995; F:insulin-like growth factor II binding; ISO:MGI GO; GO:0007568; P:aging; IEA:Ensembl GO; GO:0008286; P:insulin receptor signaling pathway; IEA:Ensembl GO; GO:0030307; P:positive regulation of cell growth; IEA:Ensembl GO; GO:0043567; P:regulation of insulin-like growth factor receptor signaling pathway; IBA:GO_Central GO; GO:0042246; P:tissue regeneration; IEA:Ensembl CDD; cd00191; TY; 1 Gene3D; 4.10.800.10; -; 1 InterPro; IPR009030; Growth_fac_rcpt_cys_sf InterPro; IPR000867; IGFBP-like InterPro; IPR022322; IGFBP1 InterPro; IPR009168; IGFBP1-6 InterPro; IPR022321; IGFBP_1-6_chordata InterPro; IPR017891; Insulin_GF-bd_Cys-rich_CS InterPro; IPR000716; Thyroglobulin_1 InterPro; IPR036857; Thyroglobulin_1_sf PANTHER; PTHR11551; PTHR11551; 1 Pfam; PF00219; IGFBP; 1 Pfam; PF00086; Thyroglobulin_1; 1 PRINTS; PR01976; IGFBPFAMILY PRINTS; PR01977; IGFBPFAMILY1 SMART; SM00121; IB; 1 SMART; SM00211; TY; 1 SUPFAM; SSF57184; SSF57184; 1 SUPFAM; SSF57610; SSF57610; 1 PROSITE; PS00222; IGFBP_N_1; 1 PROSITE; PS51323; IGFBP_N_2; 1 PROSITE; PS00484; THYROGLOBULIN_1_1; 1 PROSITE; PS51162; THYROGLOBULIN_1_2; 1 2: Evidence at transcript level; Complete proteome; Disulfide bond; Growth factor binding; Phosphoprotein; Reference proteome; Secreted; Signal SIGNAL 1 25 CHAIN 26 272 Insulin-like growth factor-binding protein 1 /FTId=PRO_0000014366 DOMAIN 28 109 IGFBP N-terminal. {ECO:0000255|PROSITE- ProRule:PRU00653} DOMAIN 186 264 Thyroglobulin type-1 {ECO:0000255|PROSITE-ProRule:PRU00500} MOTIF 259 261 Cell attachment site MOD_RES 139 139 Phosphoserine {ECO:0000250|UniProtKB:P08833} MOD_RES 157 157 Phosphoserine {ECO:0000250|UniProtKB:P08833} MOD_RES 169 169 Phosphoserine {ECO:0000250|UniProtKB:P08833} MOD_RES 170 170 Phosphothreonine {ECO:0000250|UniProtKB:P08833} MOD_RES 171 171 Phosphotyrosine {ECO:0000250|UniProtKB:P08833} MOD_RES 255 255 Phosphoserine {ECO:0000250|UniProtKB:P08833} DISULFID 73 86 {ECO:0000255|PROSITE-ProRule:PRU00500} DISULFID 80 106 {ECO:0000255|PROSITE-ProRule:PRU00500} DISULFID 189 219 {ECO:0000255|PROSITE-ProRule:PRU00500} DISULFID 230 241 {ECO:0000255|PROSITE-ProRule:PRU00500} DISULFID 243 264 {ECO:0000255|PROSITE-ProRule:PRU00500} CONFLICT 23 23 A -> V (in Ref. 1; CAA57269) CONFLICT 106 107 CV -> SL (in Ref. 4; CAA47832) CONFLICT 229 229 Q -> E (in Ref. 1; CAA57269) SEQUENCE 272 AA; 29570 MW; CD4FCD3C5AB69B60 CRC64; MPEFLTVVSW PFLILLSFQI GVAAGAPQPW HCAPCTAERL GLCPPVPASC PEISRPAGCG CCPTCALPMG AACGVATARC AQGLSCRALP GEPRPLHALT RGQGACVPEP AAPATSTLFS SQHEEAKAAV VSADELSESP EMTEEQLLDS FHLMAPSRED QPILWNAIST YSSMRAREIA DLKKWKEPCQ RELYKVLERL AAAQQKAGDE IYKFYLPNCN KNGFYHSKQC ETSLDGEAGL CWCVYPWSGK KIPGSLETRG DPNCHQYFNV HN
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to
info@abgent.com, and receive a free "I Love Antibodies" mug.

Background

IGFBP1, Insulin-like growth factor-binding protein 1, also known as placental protein 12 (PP12), is a protein that in humans is encoded by the IGFBP1 gene. The IGFBP1 gene has 4 exons and spans 5.9 kb. And the IGFBP1gene is localized to 7p13-p12 by in situ hybridization. This gene is a member of the Insulin-like growth factor-binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a type-I thyroglobulin domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

FeedBack
Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abgent.com.

$ 240.00
Cat# ABO12290
Size:
Quantity:
Availability: 3-5 days
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions
"