Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Signal Transduction   >   Anti-MMP-9 Antibody   

Anti-MMP-9 Antibody

     
  • WB - Anti-MMP-9 Antibody ABO12355
    Anti- MMP-9 Picoband antibody, ABO12355, Western blottingAll lanes: Anti MMP-9 (ABO12355) at 0.5ug/mlLane 1: NRK Whole Cell Lysate at 40ugLane 2: ANA-1 Whole Cell Lysate at 40ugLane 3: HEPA Whole Cell Lysate at 40ugPredicted bind size: 78KDObserved bind size: 78KD
  • IHC - Anti-MMP-9 Antibody ABO12355
    Anti- MMP-9 Picoband antibody, ABO12355, IHC(P)IHC(P): Mouse Kidney Tissue
  • IHC - Anti-MMP-9 Antibody ABO12355
    Anti- MMP-9 Picoband antibody, ABO12355, IHC(P)IHC(P): Rat Liver Tissue
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
WB, IHC-P, E
Primary Accession P41245
Host Rabbit
Reactivity Mouse, Rat
Clonality Polyclonal
Format Lyophilized
Description Rabbit IgG polyclonal antibody for Matrix metalloproteinase-9(MMP9) detection. Tested with WB, IHC-P, ELISA in Mouse;Rat.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Additional Information
Gene ID 17395
Other Names Matrix metalloproteinase-9, MMP-9, 3.4.24.35, 92 kDa gelatinase, 92 kDa type IV collagenase, Gelatinase B, GELB, Mmp9, Clg4b
Calculated MW 80535 MW KDa
Application Details Immunohistochemistry(Paraffin-embedded Section), 0.5-1 µg/ml, Mouse, Rat, By Heat

ELISA , 0.1-0.5 µg/ml, Mouse, -
Western blot, 0.1-0.5 µg/ml, Mouse, Rat
Subcellular Localization Secreted, extracellular space, extracellular matrix .
Protein Name Matrix metalloproteinase-9
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of mouse MMP-9 (641-672aa KALLFSKGRVWRFDLKSQKVDPQSVIRVDKEF), different from the related human sequence by thirteen amino acids, and from the related rat sequence by eight amino acids.
Purification Immunogen affinity purified.
Cross Reactivity No cross reactivity with other proteins
Storage At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Information
Name Mmp9
Synonyms Clg4b
Function Could play a role in bone osteoclastic resorption. Cleaves type IV and type V collagen into large C-terminal three quarter fragments and shorter N-terminal one quarter fragments (By similarity).
Cellular Location Secreted, extracellular space, extracellular matrix
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to
info@abgent.com, and receive a free "I Love Antibodies" mug.

Background

Matrix metallopeptidase 9 (MMP-9), also known as 92 kDa type IV collagenase, 92 kDa gelatinase or gelatinase B (GELB), is an enzyme that in humans is encoded by the MMP9 gene. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades type IV and V collagens. Studies in rhesus monkeys suggest that the enzyme is involved in IL-8-induced mobilization of hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling.

FeedBack
Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abgent.com.

$ 280.00
Cat# ABO12355
Size:
Quantity:
Availability: 3-5 days
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions
"