Register or Login
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Signal Transduction   >   Anti-GRK3 Picoband Antibody   

Anti-GRK3 Picoband Antibody

  • WB - Anti-GRK3 Picoband Antibody ABO12368
    Anti- GRK Picoband antibody, ABO12368, Western blottingAll lanes: Anti GRK3(ABO12368) at 0.5ug/mlWB: JURKAT Whole Cell Lysate at 40ugPredicted bind size: 80KDObserved bind size: 80KD
Product Information
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
Primary Accession P35626
Host Rabbit
Reactivity Human
Clonality Polyclonal
Format Lyophilized
Description Rabbit IgG polyclonal antibody for Beta-adrenergic receptor kinase 2(ADRBK2) detection. Tested with WB in Human.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Additional Information
Gene ID 157
Other Names Beta-adrenergic receptor kinase 2, Beta-ARK-2,, G-protein-coupled receptor kinase 3 {ECO:0000312|MIM:109636}, GRK3 {ECO:0000312|MIM:109636}, ADRBK2, BARK2
Calculated MW 79710 MW KDa
Application Details Western blot, 0.1-0.5 µg/ml, Human
Protein Name Beta-adrenergic receptor kinase 2
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human GRK3 (635-669aa ESDPEFVQWKKELNETFKEAQRLLRRAPKFLNKPR), different from the related mouse and rat sequences by five amino acids.
Purification Immunogen affinity purified.
Cross Reactivity No cross reactivity with other proteins
Storage At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Information
Name GRK3 {ECO:0000312|MIM:109636}
Synonyms ADRBK2, BARK2
Function Specifically phosphorylates the agonist-occupied form of the beta-adrenergic and closely related receptors.
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to, and receive a free "I Love Antibodies" mug.


Beta-adrenergic receptor kinase 2 (beta-ARK-2), also known as G-protein-coupled receptor kinase 3 (GRK3), is an enzyme that in humans is encoded by the ADRBK2 gene. The human ADRBK2 gene is located on 22q11. The beta-adrenergic receptor kinase specifically phosphorylates the agonist-occupied form of the beta-adrenergic and related G protein-coupled receptors. Overall, the beta adrenergic receptor kinase 2 has 85% amino acid similarity with beta adrenergic receptor kinase 1, with the protein kinase catalytic domain having 95% similarity. These data suggest the existence of a family of receptor kinases which may serve broadly to regulate receptor function.

Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at

$ 240.00
Cat# ABO12368
Availability: 3-5 days
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions