Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Signal Transduction   >   Anti-LIM Kinase 2 Picoband Antibody   

Anti-LIM Kinase 2 Picoband Antibody

     
  • WB - Anti-LIM Kinase 2 Picoband Antibody ABO12403
    Anti- LIM kinase 2 Picoband antibody, ABO12403, Western blottingAll lanes: Anti LIM kinase 2 (ABO12403) at 0.5ug/mlLane 1: Mouse Brain Tissue Lysate at 50ugLane 2: Mouse Liver Tissue Lysate at 50ugLane 3: Mouse Thymus Tissue Lysate at 50ugLane 4: Mouse Testis Tissue Lysate at 50ugLane 5: 293T Whole Cell Lysate at 40ugLane 6: HELA Whole Cell Lysate at 40ugPredicted bind size: 72KDObserved bind size: 72KD
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
WB
Primary Accession P53671
Host Rabbit
Reactivity Human, Mouse
Clonality Polyclonal
Format Lyophilized
Description Rabbit IgG polyclonal antibody for LIM domain kinase 2(LIMK2) detection. Tested with WB in Human;Mouse.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Additional Information
Gene ID 3985
Other Names LIM domain kinase 2, LIMK-2, 2.7.11.1, LIMK2
Calculated MW 72232 MW KDa
Application Details Western blot, 0.1-0.5 µg/ml, Human, Mouse
Subcellular Localization Isoform LIMK2a: Cytoplasm. Nucleus. Isoform LIMK2a is distributed in the cytoplasm and the nucleus.
Tissue Specificity Highest expression in the placenta; moderate level in liver, lung, kidney, and pancreas. LIMK2a is found to be more abundant then LIMK2b in liver, colon, stomach, and spleen, while in brain, kidney, and placenta LIMK2b is the dominant form. In adult lung, both LIMK2a and LIMK2b is nearly equally observed. .
Protein Name LIM domain kinase 2
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human LIM kinase 2 (596-635aa KLEDSFEALSLYLGELGIPLPAELEELDHTVSMQYGLTRD), different from the related mouse sequence by four amino acids, and from the related rat sequence by three amino a
Purification Immunogen affinity purified.
Cross Reactivity No cross reactivity with other proteins
Storage At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Information
Name LIMK2
Function Displays serine/threonine-specific phosphorylation of myelin basic protein and histone (MBP) in vitro.
Cellular Location Isoform LIMK2a: Cytoplasm. Nucleus. Note=Isoform LIMK2a is distributed in the cytoplasm and the nucleus
Tissue Location Highest expression in the placenta; moderate level in liver, lung, kidney, and pancreas. LIMK2a is found to be more abundant then LIMK2b in liver, colon, stomach, and spleen, while in brain, kidney, and placenta LIMK2b is the dominant form In adult lung, both LIMK2a and LIMK2b is nearly equally observed
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to
info@abgent.com, and receive a free "I Love Antibodies" mug.

Background

LIM domain kinase 2 is an enzyme that in humans is encoded by the LIMK2 gene. There are approximately 40 known eukaryotic LIM proteins, so named for the LIM domains they contain. LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers. Although zinc fingers usually function by binding to DNA or RNA, the LIM motif probably mediates protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2 N-terminal LIM motifs and a C-terminal protein kinase domain. The protein encoded by this gene is phosphorylated and activated by ROCK, a downstream effector of Rho, and the encoded protein, in turn, phosphorylates cofilin, inhibiting its actin-depolymerizing activity. It is thought that this pathway contributes to Rho-induced reorganization of the actin cytoskeleton. At least three transcript variants encoding different isoforms have been found for this gene.

FeedBack
Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abgent.com.

$ 240.00
Cat# ABO12403
Size:
Quantity:
Availability: 3-5 days
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions
"