Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Signal Transduction   >   Anti-c-Rel Picoband Antibody   

Anti-c-Rel Picoband Antibody

     
  • WB - Anti-c-Rel Picoband Antibody ABO12427
    Anti- c-Rel Picoband antibody, ABO12427, Western blottingAll lanes: Anti c-Rel (ABO12427) at 0.5ug/mlLane 1: Rat Kidney Tissue Lysate at 50ugLane 2: HELA Whole Cell Lysate at 40ugPredicted bind size: 69KDObserved bind size: 69KD
  • IHC - Anti-c-Rel Picoband Antibody ABO12427
    Anti- c-Rel Picoband antibody, ABO12427,IHC(P)IHC(P): Mouse Intestine Tissue
  • IHC - Anti-c-Rel Picoband Antibody ABO12427
    Anti- c-Rel Picoband antibody, ABO12427,IHC(P)IHC(P): Rat Intestine Tissue
  • IHC - Anti-c-Rel Picoband Antibody ABO12427
    Anti- c-Rel Picoband antibody, ABO12427,IHC(P)IHC(P): Human Mammary Cancer Tissue
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
WB, IHC-P
Primary Accession P15307
Host Rabbit
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Format Lyophilized
Description Rabbit IgG polyclonal antibody for Proto-oncogene c-Rel(REL) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Additional Information
Other Names Proto-oncogene c-Rel, Rel
Calculated MW 64960 MW KDa
Application Details Immunohistochemistry(Paraffin-embedded Section), 0.5-1 µg/ml, Human, Mouse, Rat, By Heat

Western blot, 0.1-0.5 µg/ml, Human, Rat
Subcellular Localization Nucleus.
Protein Name Proto-oncogene c-Rel
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen A synthetic peptide corresponding to a sequence in the middle region of mouse c-Rel (268-306aa DQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIFQKLLQD), different from the related human sequence by four amino acids.
Purification Immunogen affinity purified.
Cross Reactivity No cross reactivity with other proteins.
Storage At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Information
Name Rel
Function Proto-oncogene that may play a role in differentiation and lymphopoiesis. NF-kappa-B is a pleiotropic transcription factor which is present in almost all cell types and is involved in many biological processes such as inflammation, immunity, differentiation, cell growth, tumorigenesis and apoptosis. NF- kappa-B is a homo- or heterodimeric complex formed by the Rel-like domain-containing proteins RELA/p65, RELB, NFKB1/p105, NFKB1/p50, REL and NFKB2/p52. The dimers bind at kappa-B sites in the DNA of their target genes and the individual dimers have distinct preferences for different kappa-B sites that they can bind with distinguishable affinity and specificity. Different dimer combinations act as transcriptional activators or repressors, respectively. NF-kappa-B is controlled by various mechanisms of post-translational modification and subcellular compartmentalization as well as by interactions with other cofactors or corepressors. NF-kappa-B complexes are held in the cytoplasm in an inactive state complexed with members of the NF- kappa-B inhibitor (I-kappa-B) family. In a conventional activation pathway, I-kappa-B is phosphorylated by I-kappa-B kinases (IKKs) in response to different activators, subsequently degraded thus liberating the active NF-kappa-B complex which translocates to the nucleus. The NF-kappa-B heterodimer RELA/p65-c-Rel is a transcriptional activator (By similarity).
Cellular Location Nucleus. EMBL; X15842; CAA33843.1; ALT_SEQ; mRNA EMBL; X60271; CAA42817.1; -; mRNA PIR; A60367; A60367 UniGene; Mm.4869; - ProteinModelPortal; P15307; - SMR; P15307; - DIP; DIP-59241N; - IntAct; P15307; 7 STRING; 10090.ENSMUSP00000099928; - iPTMnet; P15307; - PhosphoSitePlus; P15307; - EPD; P15307; - MaxQB; P15307; - PaxDb; P15307; - PRIDE; P15307; - MGI; MGI:97897; Rel eggNOG; ENOG410IG8F; Eukaryota eggNOG; ENOG410XT64; LUCA HOVERGEN; HBG017916; - InParanoid; P15307; - ChiTaRS; Rel; mouse PRO; PR:P15307; - Proteomes; UP000000589; Unplaced GO; GO:0005737; C:cytoplasm; IDA:MGI GO; GO:0005829; C:cytosol; IBA:GO_Central GO; GO:0005654; C:nucleoplasm; IBA:GO_Central GO; GO:0005634; C:nucleus; IDA:MGI GO; GO:0005667; C:transcription factor complex; ISO:MGI GO; GO:0003682; F:chromatin binding; IBA:GO_Central GO; GO:0001228; F:DNA-binding transcription activator activity, RNA polymerase II-specific; ISO:MGI GO; GO:0003700; F:DNA-binding transcription factor activity; IDA:MGI GO; GO:0000981; F:DNA-binding transcription factor activity, RNA polymerase II-specific; IBA:GO_Central GO; GO:0000980; F:RNA polymerase II distal enhancer sequence-specific DNA binding; ISO:MGI GO; GO:0000977; F:RNA polymerase II regulatory region sequence-specific DNA binding; IBA:GO_Central GO; GO:0043565; F:sequence-specific DNA binding; ISO:MGI GO; GO:0001816; P:cytokine production; IMP:MGI GO; GO:0007249; P:I-kappaB kinase/NF-kappaB signaling; ISO:MGI GO; GO:0006954; P:inflammatory response; IBA:GO_Central GO; GO:0010629; P:negative regulation of gene expression; ISO:MGI GO; GO:0032688; P:negative regulation of interferon-beta production; ISO:MGI GO; GO:1901215; P:negative regulation of neuron death; ISO:MGI GO; GO:0000122; P:negative regulation of transcription by RNA polymerase II; IBA:GO_Central GO; GO:0038061; P:NIK/NF-kappaB signaling; IBA:GO_Central GO; GO:0045084; P:positive regulation of interleukin-12 biosynthetic process; IMP:MGI GO; GO:0045944; P:positive regulation of transcription by RNA polymerase II; ISO:MGI GO; GO:0045893; P:positive regulation of transcription, DNA-templated; IDA:MGI GO; GO:0034097; P:response to cytokine; IBA:GO_Central CDD; cd01177; IPT_NFkappaB; 1 Gene3D; 2.60.40.10; -; 1 Gene3D; 2.60.40.340; -; 1 InterPro; IPR030505; c-Rel InterPro; IPR013783; Ig-like_fold InterPro; IPR014756; Ig_E-set InterPro; IPR002909; IPT_dom InterPro; IPR033926; IPT_NFkappaB InterPro; IPR000451; NFkB/Dor InterPro; IPR008967; p53-like_TF_DNA-bd InterPro; IPR030492; RHD_CS InterPro; IPR032397; RHD_dimer InterPro; IPR011539; RHD_DNA_bind_dom InterPro; IPR037059; RHD_DNA_bind_dom_sf PANTHER; PTHR24169; PTHR24169; 1 PANTHER; PTHR24169:SF4; PTHR24169:SF4; 1 Pfam; PF16179; RHD_dimer; 1 Pfam; PF00554; RHD_DNA_bind; 1 PRINTS; PR00057; NFKBTNSCPFCT SMART; SM00429; IPT; 1 SUPFAM; SSF49417; SSF49417; 1 SUPFAM; SSF81296; SSF81296; 1 PROSITE; PS01204; REL_1; 1 PROSITE; PS50254; REL_2; 1 1: Evidence at protein level; Acetylation; Complete proteome; DNA-binding; Nucleus; Phosphoprotein; Proto-oncogene; Reference proteome; Transcription; Transcription regulation INIT_MET 1 1 Removed. {ECO:0000250|UniProtKB:Q04864} CHAIN 2 587 Proto-oncogene c-Rel /FTId=PRO_0000205166 DOMAIN 8 297 RHD. {ECO:0000255|PROSITE- ProRule:PRU00265} REGION 403 468 Transcriptional transactivator MOTIF 291 296 Nuclear localization signal MOD_RES 2 2 N-acetylalanine {ECO:0000250|UniProtKB:Q04864} MOD_RES 267 267 Phosphoserine; by PKA. CONFLICT 117 117 G -> E (in Ref. 3; no nucleotide entry) CONFLICT 133 133 G -> P (in Ref. 3; no nucleotide entry) CONFLICT 150 154 CVFMF -> LCFQV (in Ref. 3; no nucleotide entry). CONFLICT 160 160 D -> H (in Ref. 3; no nucleotide entry) CONFLICT 567 567 S -> SS (in Ref. 3; no nucleotide entry) SEQUENCE 587 AA; 64960 MW; 98FC237B6D140416 CRC64; MASSGYNPYV EIIEQPRQRG MRFRYKCEGR SAGSIPGERS TDNNRTYPSV QIMNYYGKGK IRITLVTKND PYKPHPHDLV GKDCRDGYYE AEFGPERRPL FFQNLGIRCV KKKEVKGAII LRISAGINPF NVGEQQLLDI EDCDLNVVRC VFMFFLPDED GNFTTALPPI VSNPIYDNRA PNTAELRICR VNKNCGSVRG GDEIFLLCDK VQKDDIEVRF VLNDWEARGV FSQADVHRQV AIVFKTPPYC KAILEPVTVK MQLRRPSDQE VSESMDFRYL PDEKDAYGNK SKKQKTTLIF QKLLQDCGHF TEKPRTAPLG STGEGRFIKK ESNLFSHGTV LPEMPRSSGV PGQAEPYYSS CGSISSGLPH HPPAIPSVAH QPTSWPPVTH PTSHPVSTNT LSTFSAGTLS SNSQGILPFL EGPGVSDLSA SNSCLYNPDD LARMETPSMS PTDLYSISDV NMLSTRPLSV MAPSTDGMGD TDNPRLVSIN LENPSCNARL GPRDLRQLHQ MSPASLSAGT SSSSVFVSQS DAFDRSNFSC VDNGLMNEPG LSDDANNPTF VQSSHYSVNT LQSEQLSDPF TYGFFKI
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to
info@abgent.com, and receive a free "I Love Antibodies" mug.

Background

The proto-oncogene c-Rel is a protein that in humans is encoded by the REL gene. This gene is mapped to chromosome 2p13-p12. The c-Rel protein is a member of the NF-κB family of transcription factors and contains a Rel homology domain (RHD) at its N-terminus and two C-terminal transactivation domains. c-Rel has an important role in B-cell survival and proliferation. The REL gene is amplified or mutated in several human B-cell lymphomas, including diffuse large B-cell lymphoma and Hodgkin's lymphoma.

FeedBack
Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abgent.com.

$ 280.00
Cat# ABO12427
Size:
Quantity:
Availability: 3-5 days
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions
"