Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Immunology   >   Anti-PIGR Picoband Antibody   

Anti-PIGR Picoband Antibody

     
  • WB - Anti-PIGR Picoband Antibody ABO12462
    Anti- PIGR Picoband antibody, ABO12462, Western blottingAll lanes: Anti PIGR (ABO12462) at 0.5ug/mlLane 1: HELA Whole Cell Lysate at 40ugLane 2: SKOV Whole Cell Lysate at 40ugLane 3: MCF-7 Whole Cell Lysate at 40ugLane 4: SW620 Whole Cell Lysate at 40ugPredicted bind size: 83KDObserved bind size: 83KD
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
WB
Primary Accession P01833
Host Rabbit
Reactivity Human
Clonality Polyclonal
Format Lyophilized
Description Rabbit IgG polyclonal antibody for Polymeric immunoglobulin receptor(PIGR) detection. Tested with WB in Human.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Additional Information
Gene ID 5284
Other Names Polymeric immunoglobulin receptor, PIgR, Poly-Ig receptor, Hepatocellular carcinoma-associated protein TB6, Secretory component, PIGR
Calculated MW 83284 MW KDa
Application Details Western blot, 0.1-0.5 µg/ml, Human
Subcellular Localization Cell membrane; Single-pass type I membrane protein.
Protein Name Polymeric immunoglobulin receptor
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human PIGR (579-613aa DAAPDEKVLDSGFREIENKAIQDPRLFAEEKAVAD), different from the related rat sequence by eighteen amino acids.
Purification Immunogen affinity purified.
Cross Reactivity No cross reactivity with other proteins.
Storage At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Information
Name PIGR
Function This receptor binds polymeric IgA and IgM at the basolateral surface of epithelial cells. The complex is then transported across the cell to be secreted at the apical surface. During this process a cleavage occurs that separates the extracellular (known as the secretory component) from the transmembrane segment.
Cellular Location Cell membrane; Single-pass type I membrane protein
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to
info@abgent.com, and receive a free "I Love Antibodies" mug.

Background

Polymeric immunoglobulin receptor is a protein that in humans is encoded by the PIGR gene. It is a Fc receptor which facilitates the secretion of the soluble polymeric isoforms of immunoglobulin A and immunoglobulin M. This gene is mapped to 1q31-q41. The encoded poly-Ig receptor binds polymeric immunoglobulin molecules at the basolateral surface of epithelial cells; the complex is then transported across the cell to be secreted at the apical surface. A significant association was found between immunoglobulin A nephropathy and several SNPs in this gene.

FeedBack
Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abgent.com.

$ 240.00
Cat# ABO12462
Size:
Quantity:
Availability: 3-5 days
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions
"