Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Signal Transduction   >   Anti-STXBP2 Picoband Antibody   

Anti-STXBP2 Picoband Antibody

     
  • WB - Anti-STXBP2 Picoband Antibody ABO12506
    Anti- STXBP2 Picoband antibody, ABO12506, Western blottingAll lanes: Anti STXBP2 (ABO12506) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Mouse Brain Tissue Lysate at 50ugLane 3: HEPG2 Whole Cell Lysate at 40ugLane 4: HELA Whole Cell Lysate at 40ugPredicted bind size: 66KDObserved bind size: 66KD
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
WB
Primary Accession Q15833
Host Rabbit
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Format Lyophilized
Description Rabbit IgG polyclonal antibody for Syntaxin-binding protein 2(STXBP2) detection. Tested with WB in Human;Mouse;Rat
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Additional Information
Gene ID 6813
Other Names Syntaxin-binding protein 2, Protein unc-18 homolog 2, Unc18-2, Protein unc-18 homolog B, Unc-18B, STXBP2, UNC18B
Calculated MW 66453 MW KDa
Application Details Western blot, 0.1-0.5 µg/ml, Human, Mouse, Rat
Tissue Specificity Placenta, lung, liver, kidney and pancreas, as well as in peripheral blood lymphocytes.
Protein Name Syntaxin-binding protein 2
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human STXBP2 (184-215aa QEYPAIRYRKGPEDTAQLAHAVLAKLNAFKAD), different from the related mouse and rat sequences by one amino acid.
Purification Immunogen affinity purified.
Cross Reactivity No cross reactivity with other proteins
Storage At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Information
Name STXBP2
Synonyms UNC18B
Function Involved in intracellular vesicle trafficking and vesicle fusion with membranes. Contributes to the granule exocytosis machinery through interaction with soluble N- ethylmaleimide-sensitive factor attachment protein receptor (SNARE) proteins that regulate membrane fusion. Regulates cytotoxic granule exocytosis in natural killer (NK) cells.
Tissue Location Placenta, lung, liver, kidney and pancreas, as well as in peripheral blood lymphocytes
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to
info@abgent.com, and receive a free "I Love Antibodies" mug.

Background

Syntaxin-binding protein 2, also known as UNC18B, is a protein that in humans is encoded by the STXBP2 gene. The STXBP2 gene is mapped to human chromosome 19p13.3-p13.2 and to the proximal arm of mouse chromosome 8. And this gene encodes a member of the STXBP/unc-18/SEC1 family. The encoded protein is involved in intracellular trafficking, control of SNARE (soluble NSF attachment protein receptor) complex assembly, and the release of cytotoxic granules by natural killer cells. Additionally, UNC18B is expressed predominantly as a 2.4-kb message in placenta, lung, liver, kidney, and pancreas, as well as in peripheral blood lymphocytes. Mutations in this gene are associated with familial hemophagocytic lymphohistiocytosis. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.

FeedBack
Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abgent.com.

$ 240.00
Cat# ABO12506
Size:
Quantity:
Availability: 3-5 days
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions
"