Foundational characteristics of cancer include proliferation, angiogenesis, migration, evasion of apoptosis, and cellular immortality. Find key markers for these cellular processes and antibodies to detect them.
The SUMOplot™ Analysis Program predicts and scores sumoylation sites in your protein. SUMOylation is a post-translational modification involved in various cellular processes, such as nuclear-cytosolic transport, transcriptional regulation, apoptosis, protein stability, response to stress, and progression through the cell cycle.
The Autophagy Receptor Motif Plotter predicts and scores autophagy receptor binding sites in your protein. Identifying proteins connected to this pathway is critical to understanding the role of autophagy in physiological as well as pathological processes such as development, differentiation, neurodegenerative diseases, stress, infection, and cancer.> home > Products > Primary Antibodies > Antibody Collections > Goat Antibodies > Goat Anti-GBX2 Antibody
Goat Anti-GBX2 Antibody
Peptide-affinity purified goat antibody
- SPECIFICATION
- CITATIONS
- PROTOCOLS
- BACKGROUND
Application 
| WB, IHC, E |
|---|---|
| Primary Accession | P52951 |
| Other Accession | NP_001476, 2637, 14472 (mouse), 114500 (rat) |
| Reactivity | Human |
| Predicted | Mouse, Rat, Pig, Dog, Cow |
| Host | Goat |
| Clonality | Polyclonal |
| Concentration | 100ug/200ul |
| Isotype | IgG |
| Other Names | Homeobox protein GBX-2, Gastrulation and brain-specific homeobox protein 2, GBX2 |
|---|---|
| Format | 0.5 mg IgG/ml in Tris saline (20mM Tris pH7.3, 150mM NaCl), 0.02% sodium azide, with 0.5% bovine serum albumin |
| Storage | Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Precautions | Goat Anti-GBX2 Antibody is for research use only and not for use in diagnostic or therapeutic procedures. |
| Name | GBX2 |
|---|---|
| Function | May act as a transcription factor for cell pluripotency and differentiation in the embryo. |
| Cellular Location | Nucleus. EMBL; U31468; AAC03241.1; -; Genomic_DNA EMBL; AF118452; AAD39907.1; -; mRNA EMBL; AC079135; AAX93240.1; -; Genomic_DNA EMBL; CH471063; EAW71084.1; -; Genomic_DNA EMBL; BC137448; AAI37449.1; -; mRNA EMBL; BC137449; AAI37450.1; -; mRNA EMBL; U02080; AAA17406.1; -; Genomic_DNA CCDS; CCDS2515.1; - PIR; S39540; S39540 RefSeq; NP_001476.2; NM_001485.3 UniGene; Hs.184945; - UniGene; Hs.735751; - ProteinModelPortal; P52951; - SMR; P52951; - BioGrid; 108907; 3 STRING; 9606.ENSP00000302251; - iPTMnet; P52951; - PhosphoSitePlus; P52951; - BioMuta; GBX2; - DMDM; 12644308; - EPD; P52951; - MaxQB; P52951; - PaxDb; P52951; - PeptideAtlas; P52951; - PRIDE; P52951; - ProteomicsDB; 56561; - Ensembl; ENST00000306318; ENSP00000302251; ENSG00000168505 GeneID; 2637; - KEGG; hsa:2637; - UCSC; uc002vvw.2; human CTD; 2637; - DisGeNET; 2637; - EuPathDB; HostDB:ENSG00000168505.6; - GeneCards; GBX2; - HGNC; HGNC:4186; GBX2 HPA; HPA067809; - MIM; 601135; gene neXtProt; NX_P52951; - OpenTargets; ENSG00000168505; - PharmGKB; PA28600; - eggNOG; KOG0489; Eukaryota eggNOG; ENOG410ZTBY; LUCA GeneTree; ENSGT00940000154365; - HOGENOM; HOG000060099; - HOVERGEN; HBG003967; - InParanoid; P52951; - KO; K09321; - OMA; FMPYRSV; - OrthoDB; 1406210at2759; - PhylomeDB; P52951; - TreeFam; TF351530; - GeneWiki; GBX2; - GenomeRNAi; 2637; - PRO; PR:P52951; - Proteomes; UP000005640; Chromosome 2 Bgee; ENSG00000168505; Expressed in 26 organ(s), highest expression level in cerebellum ExpressionAtlas; P52951; baseline and differential Genevisible; P52951; HS GO; GO:0005634; C:nucleus; IBA:GO_Central GO; GO:0001228; F:DNA-binding transcription activator activity, RNA polymerase II-specific; IBA:GO_Central GO; GO:0003700; F:DNA-binding transcription factor activity; TAS:ProtInc GO; GO:0000981; F:DNA-binding transcription factor activity, RNA polymerase II-specific; ISA:NTNU_SB GO; GO:0000979; F:RNA polymerase II core promoter sequence-specific DNA binding; IEA:Ensembl GO; GO:0000977; F:RNA polymerase II regulatory region sequence-specific DNA binding; IBA:GO_Central GO; GO:0048483; P:autonomic nervous system development; IEA:Ensembl GO; GO:0007411; P:axon guidance; IEA:Ensembl GO; GO:0001569; P:branching involved in blood vessel morphogenesis; IEA:Ensembl GO; GO:0021930; P:cerebellar granule cell precursor proliferation; IEA:Ensembl GO; GO:0021549; P:cerebellum development; IBA:GO_Central GO; GO:0021884; P:forebrain neuron development; IEA:Ensembl GO; GO:0030902; P:hindbrain development; IBA:GO_Central GO; GO:0042472; P:inner ear morphogenesis; IEA:Ensembl GO; GO:0021555; P:midbrain-hindbrain boundary morphogenesis; IEA:Ensembl GO; GO:0007399; P:nervous system development; TAS:ProtInc GO; GO:0001755; P:neural crest cell migration; IEA:Ensembl GO; GO:0051960; P:regulation of nervous system development; IBA:GO_Central GO; GO:0021568; P:rhombomere 2 development; IEA:Ensembl GO; GO:0021794; P:thalamus development; IEA:Ensembl CDD; cd00086; homeodomain; 1 InterPro; IPR031250; GBX-2 InterPro; IPR009057; Homeobox-like_sf InterPro; IPR017970; Homeobox_CS InterPro; IPR001356; Homeobox_dom InterPro; IPR020479; Homeobox_metazoa PANTHER; PTHR24334:SF3; PTHR24334:SF3; 1 Pfam; PF00046; Homeodomain; 1 PRINTS; PR00024; HOMEOBOX SMART; SM00389; HOX; 1 SUPFAM; SSF46689; SSF46689; 1 PROSITE; PS00027; HOMEOBOX_1; 1 PROSITE; PS50071; HOMEOBOX_2; 1 2: Evidence at transcript level; Complete proteome; DNA-binding; Homeobox; Nucleus; Reference proteome; Transcription; Transcription regulation CHAIN 1 348 Homeobox protein GBX-2 /FTId=PRO_0000048880 DNA_BIND 247 306 Homeobox. {ECO:0000255|PROSITE- ProRule:PRU00108} COMPBIAS 56 63 Poly-Pro COMPBIAS 121 124 Poly-Ala COMPBIAS 248 251 Poly-Arg CONFLICT 74 194 LPPAHPHHQIPSLPTGFCSSLAQGMALTSTLMATLPGGFSA SPQHQEAAAARKFAPQPLPGGGNFDKAEALQADAEDGKGFL AKEGSLLAFSAAETVQASLVGAVRGQGKDESKVEDDPKG -> CRPHTLTTRSPACPQASAPAWRRAWRSPLRSWPRSPAA SPRRPSTRRRQRPASSRRSRCPAAVTSTRRRRCRLTRRTAK ASWPKRARCSPSPRPRRCRLRSSGLSEGKGKTSQRWKTTRS (in Ref. 1; AAC03241). CONFLICT 216 237 QAAHKEEDPGHALEETPPSSGA -> PGSSQGGRPGPRGGG DPAEQRR (in Ref. 6). SEQUENCE 348 AA; 37348 MW; 5D31EA57B0CB07C0 CRC64; MSAAFPPSLM MMQRPLGSST AFSIDSLIGS PPQPSPGHFV YTGYPMFMPY RPVVLPPPPP PPPALPQAAL QPALPPAHPH HQIPSLPTGF CSSLAQGMAL TSTLMATLPG GFSASPQHQE AAAARKFAPQ PLPGGGNFDK AEALQADAED GKGFLAKEGS LLAFSAAETV QASLVGAVRG QGKDESKVED DPKGKEESFS LESDVDYSSD DNLTGQAAHK EEDPGHALEE TPPSSGAAGS TTSTGKNRRR RTAFTSEQLL ELEKEFHCKK YLSLTERSQI AHALKLSEVQ VKIWFQNRRA KWKRVKAGNA NSKTGEPSRN PKIVVPIPVH VSRFAIRSQH QQLEQARP |
Research Areas
Citations (0)
Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Submit your citation using an Abgent antibody to
info@abgent.com, and receive a free "I Love Antibodies" mug.
info@abgent.com, and receive a free "I Love Antibodies" mug.
Application Protocols
Provided below are standard protocols that you may find useful for product applications.
References
New genetic associations detected in a host response study to hepatitis B vaccine. Davila S, et al. Genes Immun, 2010 Apr. PMID 20237496.
Gbx2 and Otx2 interact with the WD40 domain of Groucho/Tle corepressors. Heimbucher T, et al. Mol Cell Biol, 2007 Jan. PMID 17060451.
Microarray analysis identifies a death-from-cancer signature predicting therapy failure in patients with multiple types of cancer. Glinsky GV, et al. J Clin Invest, 2005 Jun. PMID 15931389.
Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Hillier LW, et al. Nature, 2005 Apr 7. PMID 15815621.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. Strausberg RL, et al. Proc Natl Acad Sci U S A, 2002 Dec 24. PMID 12477932.
Abgent welcomes feedback from its customers.
If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abgent.com.
$ 368.00
Cat# AF1468a
Ordering Information
United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900
Other Products
Shipping Information
Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
