Goat Anti-GBX2 Antibody
Peptide-affinity purified goat antibody
- SPECIFICATION
- CITATIONS
- PROTOCOLS
- BACKGROUND
Application ![]()
| WB, IHC, E |
---|---|
Primary Accession | P52951 |
Other Accession | NP_001476, 2637, 14472 (mouse), 114500 (rat) |
Reactivity | Human |
Predicted | Mouse, Rat, Pig, Dog, Cow |
Host | Goat |
Clonality | Polyclonal |
Concentration | 100ug/200ul |
Isotype | IgG |
Other Names | Homeobox protein GBX-2, Gastrulation and brain-specific homeobox protein 2, GBX2 |
---|---|
Format | 0.5 mg IgG/ml in Tris saline (20mM Tris pH7.3, 150mM NaCl), 0.02% sodium azide, with 0.5% bovine serum albumin |
Storage | Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Precautions | Goat Anti-GBX2 Antibody is for research use only and not for use in diagnostic or therapeutic procedures. |
Name | GBX2 |
---|---|
Function | May act as a transcription factor for cell pluripotency and differentiation in the embryo. |
Cellular Location | Nucleus. EMBL; U31468; AAC03241.1; -; Genomic_DNA EMBL; AF118452; AAD39907.1; -; mRNA EMBL; AC079135; AAX93240.1; -; Genomic_DNA EMBL; CH471063; EAW71084.1; -; Genomic_DNA EMBL; BC137448; AAI37449.1; -; mRNA EMBL; BC137449; AAI37450.1; -; mRNA EMBL; U02080; AAA17406.1; -; Genomic_DNA CCDS; CCDS2515.1; - PIR; S39540; S39540 RefSeq; NP_001476.2; NM_001485.3 UniGene; Hs.184945; - UniGene; Hs.735751; - ProteinModelPortal; P52951; - SMR; P52951; - BioGrid; 108907; 3 STRING; 9606.ENSP00000302251; - iPTMnet; P52951; - PhosphoSitePlus; P52951; - BioMuta; GBX2; - DMDM; 12644308; - EPD; P52951; - MaxQB; P52951; - PaxDb; P52951; - PeptideAtlas; P52951; - PRIDE; P52951; - ProteomicsDB; 56561; - Ensembl; ENST00000306318; ENSP00000302251; ENSG00000168505 GeneID; 2637; - KEGG; hsa:2637; - UCSC; uc002vvw.2; human CTD; 2637; - DisGeNET; 2637; - EuPathDB; HostDB:ENSG00000168505.6; - GeneCards; GBX2; - HGNC; HGNC:4186; GBX2 HPA; HPA067809; - MIM; 601135; gene neXtProt; NX_P52951; - OpenTargets; ENSG00000168505; - PharmGKB; PA28600; - eggNOG; KOG0489; Eukaryota eggNOG; ENOG410ZTBY; LUCA GeneTree; ENSGT00910000144024; - HOGENOM; HOG000060099; - HOVERGEN; HBG003967; - InParanoid; P52951; - KO; K09321; - OMA; FMPYRSV; - OrthoDB; EOG091G0SCQ; - PhylomeDB; P52951; - TreeFam; TF351530; - GeneWiki; GBX2; - GenomeRNAi; 2637; - PRO; PR:P52951; - Proteomes; UP000005640; Chromosome 2 Bgee; ENSG00000168505; - CleanEx; HS_GBX2; - ExpressionAtlas; P52951; baseline and differential Genevisible; P52951; HS GO; GO:0005634; C:nucleus; IEA:UniProtKB-SubCell GO; GO:0003700; F:DNA binding transcription factor activity; TAS:ProtInc GO; GO:0000979; F:RNA polymerase II core promoter sequence-specific DNA binding; IEA:Ensembl GO; GO:0000981; F:RNA polymerase II transcription factor activity, sequence-specific DNA binding; ISA:NTNU_SB GO; GO:0001190; F:transcriptional activator activity, RNA polymerase II transcription factor binding; IEA:Ensembl GO; GO:0001228; F:transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific DNA binding; IEA:Ensembl GO; GO:0048483; P:autonomic nervous system development; IEA:Ensembl GO; GO:0007411; P:axon guidance; IEA:Ensembl GO; GO:0001569; P:branching involved in blood vessel morphogenesis; IEA:Ensembl GO; GO:0021930; P:cerebellar granule cell precursor proliferation; IEA:Ensembl GO; GO:0021549; P:cerebellum development; IEA:Ensembl GO; GO:0021884; P:forebrain neuron development; IEA:Ensembl GO; GO:0042472; P:inner ear morphogenesis; IEA:Ensembl GO; GO:0021555; P:midbrain-hindbrain boundary morphogenesis; IEA:Ensembl GO; GO:0007399; P:nervous system development; TAS:ProtInc GO; GO:0001755; P:neural crest cell migration; IEA:Ensembl GO; GO:0021568; P:rhombomere 2 development; IEA:Ensembl GO; GO:0021794; P:thalamus development; IEA:Ensembl CDD; cd00086; homeodomain; 1 InterPro; IPR031250; GBX-2 InterPro; IPR009057; Homeobox-like_sf InterPro; IPR017970; Homeobox_CS InterPro; IPR001356; Homeobox_dom InterPro; IPR020479; Homeobox_metazoa PANTHER; PTHR24334:SF3; PTHR24334:SF3; 1 Pfam; PF00046; Homeobox; 1 PRINTS; PR00024; HOMEOBOX SMART; SM00389; HOX; 1 SUPFAM; SSF46689; SSF46689; 1 PROSITE; PS00027; HOMEOBOX_1; 1 PROSITE; PS50071; HOMEOBOX_2; 1 2: Evidence at transcript level; Complete proteome; DNA-binding; Homeobox; Nucleus; Reference proteome; Transcription; Transcription regulation CHAIN 1 348 Homeobox protein GBX-2 /FTId=PRO_0000048880 DNA_BIND 247 306 Homeobox. {ECO:0000255|PROSITE- ProRule:PRU00108} COMPBIAS 56 63 Poly-Pro COMPBIAS 121 124 Poly-Ala COMPBIAS 248 251 Poly-Arg CONFLICT 74 194 LPPAHPHHQIPSLPTGFCSSLAQGMALTSTLMATLPGGFSA SPQHQEAAAARKFAPQPLPGGGNFDKAEALQADAEDGKGFL AKEGSLLAFSAAETVQASLVGAVRGQGKDESKVEDDPKG -> CRPHTLTTRSPACPQASAPAWRRAWRSPLRSWPRSPAA SPRRPSTRRRQRPASSRRSRCPAAVTSTRRRRCRLTRRTAK ASWPKRARCSPSPRPRRCRLRSSGLSEGKGKTSQRWKTTRS (in Ref. 1; AAC03241). CONFLICT 216 237 QAAHKEEDPGHALEETPPSSGA -> PGSSQGGRPGPRGGG DPAEQRR (in Ref. 6). SEQUENCE 348 AA; 37348 MW; 5D31EA57B0CB07C0 CRC64; MSAAFPPSLM MMQRPLGSST AFSIDSLIGS PPQPSPGHFV YTGYPMFMPY RPVVLPPPPP PPPALPQAAL QPALPPAHPH HQIPSLPTGF CSSLAQGMAL TSTLMATLPG GFSASPQHQE AAAARKFAPQ PLPGGGNFDK AEALQADAED GKGFLAKEGS LLAFSAAETV QASLVGAVRG QGKDESKVED DPKGKEESFS LESDVDYSSD DNLTGQAAHK EEDPGHALEE TPPSSGAAGS TTSTGKNRRR RTAFTSEQLL ELEKEFHCKK YLSLTERSQI AHALKLSEVQ VKIWFQNRRA KWKRVKAGNA NSKTGEPSRN PKIVVPIPVH VSRFAIRSQH QQLEQARP |

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
info@abgent.com, and receive a free "I Love Antibodies" mug.
Provided below are standard protocols that you may find useful for product applications.
References
New genetic associations detected in a host response study to hepatitis B vaccine. Davila S, et al. Genes Immun, 2010 Apr. PMID 20237496.
Gbx2 and Otx2 interact with the WD40 domain of Groucho/Tle corepressors. Heimbucher T, et al. Mol Cell Biol, 2007 Jan. PMID 17060451.
Microarray analysis identifies a death-from-cancer signature predicting therapy failure in patients with multiple types of cancer. Glinsky GV, et al. J Clin Invest, 2005 Jun. PMID 15931389.
Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Hillier LW, et al. Nature, 2005 Apr 7. PMID 15815621.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. Strausberg RL, et al. Proc Natl Acad Sci U S A, 2002 Dec 24. PMID 12477932.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abgent.com.