Register or Login
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Antibody Collections   >   Goat Antibodies   >   Goat Anti-STS2 / TULA (internal) Antibody   

Goat Anti-STS2 / TULA (internal) Antibody

Peptide-affinity purified goat antibody

  • IHC - Goat Anti-STS2 / TULA (internal) Antibody AF2046a
    AF2046a (2.5 µg/ml) staining of paraffin embedded Human Spleen. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Product Information
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
Primary Accession P57075
Other Accession NP_001001895, 53347
Reactivity Human
Predicted Dog
Host Goat
Clonality Polyclonal
Concentration 100ug/200ul
Isotype IgG
Additional Information
Other Names Ubiquitin-associated and SH3 domain-containing protein A, Cbl-interacting protein 4, CLIP4, Suppressor of T-cell receptor signaling 2, STS-2, T-cell ubiquitin ligand 1, TULA-1, UBASH3A, STS2
Format 0.5 mg IgG/ml in Tris saline (20mM Tris pH7.3, 150mM NaCl), 0.02% sodium azide, with 0.5% bovine serum albumin
StorageMaintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
PrecautionsGoat Anti-STS2 / TULA (internal) Antibody is for research use only and not for use in diagnostic or therapeutic procedures.
Protein Information
Synonyms STS2
Function Interferes with CBL-mediated down-regulation and degradation of receptor-type tyrosine kinases. Promotes accumulation of activated target receptors, such as T-cell receptors, EGFR and PDGFRB, on the cell surface. Exhibits negligigle protein tyrosine phosphatase activity at neutral pH. May act as a dominant-negative regulator of UBASH3B-dependent dephosphorylation. May inhibit dynamin-dependent endocytic pathways by functionally sequestering dynamin via its SH3 domain.
Cellular Location Cytoplasm. Nucleus.
Tissue Location Highest expression of UBASH3A in tissues belonging to the immune system, including spleen, peripheral blood leukocytes, thymus and bone marrow. EMBL; AJ277750; CAB91543.1; -; mRNA EMBL; AF520809; AAP80731.1; -; mRNA EMBL; AF521702; AAP80738.1; -; mRNA EMBL; AP001746; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; CH471079; EAX09560.1; -; Genomic_DNA EMBL; BC069357; AAH69357.1; -; mRNA EMBL; BC069483; AAH69483.1; -; mRNA EMBL; BC069511; AAH69511.1; -; mRNA EMBL; BC069577; -; NOT_ANNOTATED_CDS; mRNA CCDS; CCDS13687.1; -. [P57075-1] CCDS; CCDS33566.1; -. [P57075-2] CCDS; CCDS58791.1; -. [P57075-3] RefSeq; NP_001001895.1; NM_001001895.2. [P57075-2] RefSeq; NP_001230396.1; NM_001243467.1. [P57075-3] RefSeq; NP_061834.1; NM_018961.3. [P57075-1] UniGene; Hs.473912; - PDB; 2CRN; NMR; -; A=20-70 PDB; 5WDI; X-ray; 2.43 A; A/B=394-658 PDBsum; 2CRN; - PDBsum; 5WDI; - ProteinModelPortal; P57075; - SMR; P57075; - BioGrid; 119748; 23 IntAct; P57075; 83 MINT; P57075; - STRING; 9606.ENSP00000317327; - iPTMnet; P57075; - PhosphoSitePlus; P57075; - BioMuta; UBASH3A; - DMDM; 10720330; - MaxQB; P57075; - PaxDb; P57075; - PeptideAtlas; P57075; - PRIDE; P57075; - ProteomicsDB; 56982; - ProteomicsDB; 56983; -. [P57075-2] Ensembl; ENST00000291535; ENSP00000291535; ENSG00000160185. [P57075-2] Ensembl; ENST00000319294; ENSP00000317327; ENSG00000160185. [P57075-1] Ensembl; ENST00000398367; ENSP00000381408; ENSG00000160185. [P57075-3] GeneID; 53347; - KEGG; hsa:53347; - UCSC; uc002zbe.4; human. [P57075-1] CTD; 53347; - DisGeNET; 53347; - EuPathDB; HostDB:ENSG00000160185.14; - GeneCards; UBASH3A; - HGNC; HGNC:12462; UBASH3A HPA; HPA035367; - MIM; 605736; gene neXtProt; NX_P57075; - OpenTargets; ENSG00000160185; - PharmGKB; PA37112; - eggNOG; ENOG410IN2Z; Eukaryota eggNOG; ENOG410YCFH; LUCA GeneTree; ENSGT00390000018249; - HOGENOM; HOG000012936; - HOVERGEN; HBG018025; - InParanoid; P57075; - KO; K18993; - OMA; HRTYTFS; - OrthoDB; EOG091G0DJ2; - PhylomeDB; P57075; - TreeFam; TF313334; - SignaLink; P57075; - ChiTaRS; UBASH3A; human EvolutionaryTrace; P57075; - GeneWiki; UBASH3A; - GenomeRNAi; 53347; - PRO; PR:P57075; - Proteomes; UP000005640; Chromosome 21 Bgee; ENSG00000160185; - CleanEx; HS_UBASH3A; - ExpressionAtlas; P57075; baseline and differential Genevisible; P57075; HS GO; GO:0005829; C:cytosol; HDA:UniProtKB GO; GO:0070062; C:extracellular exosome; HDA:UniProtKB GO; GO:0005794; C:Golgi apparatus; IDA:HPA GO; GO:0005654; C:nucleoplasm; IDA:HPA GO; GO:0050860; P:negative regulation of T cell receptor signaling pathway; IEA:Ensembl GO; GO:0001817; P:regulation of cytokine production; IEA:Ensembl CDD; cd07067; HP_PGM_like; 1 CDD; cd11937; SH3_UBASH3A; 1 Gene3D;; -; 1 InterPro; IPR013078; His_Pase_superF_clade-1 InterPro; IPR029033; His_PPase_superfam InterPro; IPR036028; SH3-like_dom_sf InterPro; IPR001452; SH3_domain InterPro; IPR015940; UBA InterPro; IPR009060; UBA-like_sf InterPro; IPR035634; UBASH3A_SH3 Pfam; PF00300; His_Phos_1; 1 Pfam; PF14604; SH3_9; 1 SMART; SM00326; SH3; 1 SUPFAM; SSF46934; SSF46934; 1 SUPFAM; SSF50044; SSF50044; 1 SUPFAM; SSF53254; SSF53254; 2 PROSITE; PS50002; SH3; 1 PROSITE; PS50030; UBA; 1 1: Evidence at protein level; 3D-structure; Alternative splicing; Complete proteome; Cytoplasm; Nucleus; Polymorphism; Reference proteome; SH3 domain CHAIN 1 661 Ubiquitin-associated and SH3 domain- containing protein A /FTId=PRO_0000210994 DOMAIN 15 60 UBA. {ECO:0000255|PROSITE- ProRule:PRU00212} DOMAIN 276 341 SH3. {ECO:0000255|PROSITE- ProRule:PRU00192} REGION 395 661 Phosphatase-like VAR_SEQ 185 223 GTSVSRFWIFSQVPGHGPNLRLSNLTRASFVSHYILQKY -> D (in isoform 2 and isoform 3) /FTId=VSP_006703 VAR_SEQ 545 564 PAFPLSALMPAESYQEYMDR -> SLPWACASVKKIKRKEN GSW (in isoform 3) /FTId=VSP_045549 VAR_SEQ 565 661 Missing (in isoform 3) /FTId=VSP_045550 VARIANT 18 18 S -> G (in dbSNP:rs2277798) /FTId=VAR_026971 VARIANT 28 28 L -> F (in dbSNP:rs2277800) /FTId=VAR_026972 VARIANT 286 286 Q -> R (in dbSNP:rs775952011) /FTId=VAR_026973 VARIANT 324 324 R -> L (in dbSNP:rs13048049) /FTId=VAR_061921 VARIANT 324 324 R -> Q (in dbSNP:rs13048049) /FTId=VAR_061922 VARIANT 466 466 D -> E (in dbSNP:rs17114930) /FTId=VAR_052675 MUTAGEN 317 317 W->A: Loss of interaction with CBL MUTAGEN 317 317 W->L: Abolishes binding to dynamin CONFLICT 64 64 P -> H (in Ref. 5; AAH69511) CONFLICT 129 129 E -> K (in Ref. 5; BC069577) CONFLICT 229 229 C -> Y (in Ref. 5; AAH69511) CONFLICT 283 283 A -> V (in Ref. 5; AAH69483) CONFLICT 393 393 V -> I (in Ref. 5; AAH69511) CONFLICT 651 651 A -> V (in Ref. 5; AAH69511) HELIX 25 30 {ECO:0000244|PDB:2CRN} HELIX 35 45 {ECO:0000244|PDB:2CRN} HELIX 50 60 {ECO:0000244|PDB:2CRN} STRAND 61 63 {ECO:0000244|PDB:2CRN} STRAND 397 402 {ECO:0000244|PDB:5WDI} HELIX 407 411 {ECO:0000244|PDB:5WDI} HELIX 415 418 {ECO:0000244|PDB:5WDI} HELIX 445 447 {ECO:0000244|PDB:5WDI} HELIX 455 471 {ECO:0000244|PDB:5WDI} STRAND 475 480 {ECO:0000244|PDB:5WDI} HELIX 484 497 {ECO:0000244|PDB:5WDI} TURN 500 502 {ECO:0000244|PDB:5WDI} STRAND 505 507 {ECO:0000244|PDB:5WDI} HELIX 509 511 {ECO:0000244|PDB:5WDI} HELIX 515 517 {ECO:0000244|PDB:5WDI} HELIX 529 534 {ECO:0000244|PDB:5WDI} HELIX 549 551 {ECO:0000244|PDB:5WDI} HELIX 558 574 {ECO:0000244|PDB:5WDI} STRAND 581 587 {ECO:0000244|PDB:5WDI} HELIX 591 594 {ECO:0000244|PDB:5WDI} HELIX 597 600 {ECO:0000244|PDB:5WDI} HELIX 607 615 {ECO:0000244|PDB:5WDI} STRAND 622 628 {ECO:0000244|PDB:5WDI} TURN 629 632 {ECO:0000244|PDB:5WDI} STRAND 633 637 {ECO:0000244|PDB:5WDI} HELIX 654 657 {ECO:0000244|PDB:5WDI} SEQUENCE 661 AA; 74123 MW; 60DA2E0B8CE4ABFC CRC64; MAAGETQLYA KVSNKLKSRS SPSLLEPLLA MGFPVHTALK ALAATGRKTA EEALAWLHDH CNDPSLDDPI PQEYALFLCP TGPLLEKLQE FWRESKRQCA KNRAHEVFPH VTLCDFFTCE DQKVECLYEA LKRAGDRLLG SFPTAVPLAL HSSISYLGFF VSGSPADVIR EFAMTFATEA SLLAGTSVSR FWIFSQVPGH GPNLRLSNLT RASFVSHYIL QKYCSVKPCT KQLHLTLAHK FYPHHQRTLE QLARAIPLGH SCQWTAALYS RDMRFVHYQT LRALFQYKPQ NVDELTLSPG DYIFVDPTQQ DEASEGWVIG ISQRTGCRGF LPENYTDRAS ESDTWVKHRM YTFSLATDLN SRKDGEASSR CSGEFLPQTA RSLSSLQALQ ATVARKSVLV VRHGERVDQI FGKAWLQQCS TPDGKYYRPD LNFPCSLPRR SRGIKDFEND PPLSSCGIFQ SRIAGDALLD SGIRISSVFA SPALRCVQTA KLILEELKLE KKIKIRVEPG IFEWTKWEAG KTTPTLMSLE ELKEANFNID TDYRPAFPLS ALMPAESYQE YMDRCTASMV QIVNTCPQDT GVILIVSHGS TLDSCTRPLL GLPPRECGDF AQLVRKIPSL GMCFCEENKE EGKWELVNPP VKTLTHGANA AFNWRNWISG N
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to, and receive a free "I Love Antibodies" mug.


Investigation of type 1 diabetes and coeliac disease susceptibility loci for association with juvenile idiopathic arthritis. Hinks A, et al. Ann Rheum Dis, 2010 Jul 20. PMID 20647273.
Variant of TYR and autoimmunity susceptibility loci in generalized vitiligo. Jin Y, et al. N Engl J Med, 2010 May 6. PMID 20410501.
Genome-wide association study and meta-analysis find that over 40 loci affect risk of type 1 diabetes. Barrett JC, et al. Nat Genet, 2009 Jun. PMID 19430480.
Shared and distinct genetic variants in type 1 diabetes and celiac disease. Smyth DJ, et al. N Engl J Med, 2008 Dec 25. PMID 19073967.
Follow-up analysis of genome-wide association data identifies novel loci for type 1 diabetes. Grant SF, et al. Diabetes, 2009 Jan. PMID 18840781.

Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at

$ 368.00
Cat# AF2046a
Availability: 7-10 days
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions