Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Antibody Collections   >   Goat Antibodies   >   CHN2 Antibody (C-Term)   

CHN2 Antibody (C-Term)

Peptide-affinity purified goat antibody

     
  • IHC - CHN2 Antibody (C-Term) AF2247a
    AF2247a (3.8 µg/ml) staining of paraffin embedded Human Cortex. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
IHC, E
Primary Accession P52757
Other Accession NP_001035025.1, NP_004058.1, 1124
Reactivity Human
Predicted Mouse, Dog, Cow
Host Goat
Clonality Polyclonal
Concentration 0.5 mg/ml
Isotype IgG
Additional Information
Other Names Beta-chimaerin, Beta-chimerin, Rho GTPase-activating protein 3, CHN2, ARHGAP3, BCH
Format 0.5 mg/ml in Tris saline, 0.02% sodium azide, pH7.3 with 0.5% bovine serum albumin
StorageMaintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
PrecautionsCHN2 Antibody (C-Term) is for research use only and not for use in diagnostic or therapeutic procedures.
Protein Information
Name CHN2
Synonyms ARHGAP3, BCH
Function GTPase-activating protein for p21-rac. Insufficient expression of beta-2 chimaerin is expected to lead to higher Rac activity and could therefore play a role in the progression from low-grade to high-grade tumors.
Cellular Location Membrane; Peripheral membrane protein
Tissue Location Highest levels in the brain and pancreas. Also expressed in the heart, placenta, and weakly in the kidney and liver. Expression is much reduced in the malignant gliomas, compared to normal brain or low-grade astrocytomas EMBL; L29126; AAA19191.1; -; mRNA EMBL; U07223; AAA16836.1; -; mRNA EMBL; U28926; AAA86528.1; -; mRNA EMBL; EU732752; ACF04989.1; -; mRNA EMBL; EU732753; ACF04990.1; -; mRNA EMBL; EU732754; ACF04991.1; -; mRNA EMBL; EU732758; ACF04995.1; -; mRNA EMBL; EU732762; ACF04999.1; -; mRNA EMBL; GQ924106; ADK47390.1; -; mRNA EMBL; AK026415; -; NOT_ANNOTATED_CDS; mRNA EMBL; AK313021; BAG35856.1; -; mRNA EMBL; AK316030; BAH14401.1; -; mRNA EMBL; AC004417; AAC06177.1; -; Genomic_DNA EMBL; AC004593; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; AC005232; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; AC007096; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; AC007255; AAS07498.1; -; Genomic_DNA EMBL; CH236948; EAL24205.1; -; Genomic_DNA EMBL; CH471073; EAW93919.1; -; Genomic_DNA EMBL; BC112155; AAI12156.1; -; mRNA CCDS; CCDS47566.1; -. [P52757-3] CCDS; CCDS5420.1; -. [P52757-1] CCDS; CCDS78219.1; -. [P52757-5] CCDS; CCDS87488.1; -. [P52757-9] PIR; A53764; A53764 RefSeq; NP_001035025.1; NM_001039936.2. [P52757-3] RefSeq; NP_001279998.1; NM_001293069.1. [P52757-9] RefSeq; NP_001279999.1; NM_001293070.1 RefSeq; NP_001280000.1; NM_001293071.1 RefSeq; NP_001280002.1; NM_001293073.1. [P52757-4] RefSeq; NP_001280004.1; NM_001293075.1. [P52757-6] RefSeq; NP_001280005.1; NM_001293076.1. [P52757-5] RefSeq; NP_001280006.1; NM_001293077.1 RefSeq; NP_001280007.1; NM_001293078.1 RefSeq; NP_001280008.1; NM_001293079.1 RefSeq; NP_001280009.1; NM_001293080.1. [P52757-7] RefSeq; NP_004058.1; NM_004067.3. [P52757-1] UniGene; Hs.654611; - UniGene; Hs.710429; - UniGene; Hs.734596; - PDB; 1XA6; X-ray; 3.20 A; A=7-468 PDBsum; 1XA6; - ProteinModelPortal; P52757; - SMR; P52757; - BioGrid; 107548; 9 IntAct; P52757; 14 MINT; P52757; - STRING; 9606.ENSP00000222792; - BindingDB; P52757; - ChEMBL; CHEMBL4504; - iPTMnet; P52757; - PhosphoSitePlus; P52757; - BioMuta; CHN2; - DMDM; 2506455; - jPOST; P52757; - PaxDb; P52757; - PeptideAtlas; P52757; - PRIDE; P52757; - ProteomicsDB; 56529; - Ensembl; ENST00000222792; ENSP00000222792; ENSG00000106069. [P52757-1] Ensembl; ENST00000412711; ENSP00000486515; ENSG00000106069. [P52757-3] Ensembl; ENST00000421775; ENSP00000394284; ENSG00000106069. [P52757-5] GeneID; 1124; - KEGG; hsa:1124; - UCSC; uc003szz.4; human. [P52757-1] CTD; 1124; - DisGeNET; 1124; - EuPathDB; HostDB:ENSG00000106069.20; - GeneCards; CHN2; - HGNC; HGNC:1944; CHN2 HPA; HPA018989; - MIM; 602857; gene neXtProt; NX_P52757; - OpenTargets; ENSG00000106069; - PharmGKB; PA26474; - eggNOG; KOG1453; Eukaryota eggNOG; ENOG410YM3I; LUCA GeneTree; ENSGT00940000153726; - HOGENOM; HOG000231926; - HOVERGEN; HBG080489; - InParanoid; P52757; - KO; K20630; - OMA; IICPGEV; - OrthoDB; 1300981at2759; - PhylomeDB; P52757; - TreeFam; TF342052; - Reactome; R-HSA-194840; Rho GTPase cycle SignaLink; P52757; - SIGNOR; P52757; - ChiTaRS; CHN2; human EvolutionaryTrace; P52757; - GeneWiki; Chimerin_2; - GenomeRNAi; 1124; - PRO; PR:P52757; - Proteomes; UP000005640; Chromosome 7 Bgee; ENSG00000106069; Expressed in 204 organ(s), highest expression level in cerebellar vermis ExpressionAtlas; P52757; baseline and differential Genevisible; P52757; HS GO; GO:0005829; C:cytosol; TAS:Reactome GO; GO:0016020; C:membrane; IEA:UniProtKB-SubCell GO; GO:0005096; F:GTPase activator activity; TAS:Reactome GO; GO:0046872; F:metal ion binding; IEA:UniProtKB-KW GO; GO:0005070; F:SH3/SH2 adaptor activity; TAS:ProtInc GO; GO:0035556; P:intracellular signal transduction; IEA:InterPro GO; GO:0051056; P:regulation of small GTPase mediated signal transduction; TAS:Reactome CDD; cd00029; C1; 1 CDD; cd04372; RhoGAP_chimaerin; 1 CDD; cd10352; SH2_a2chimerin_b2chimerin; 1 Gene3D; 1.10.555.10; -; 1 Gene3D; 3.30.505.10; -; 1 InterPro; IPR035840; Chimaerin_SH2 InterPro; IPR017356; CHN1/CHN2 InterPro; IPR020454; DAG/PE-bd InterPro; IPR002219; PE/DAG-bd InterPro; IPR008936; Rho_GTPase_activation_prot InterPro; IPR037860; RhoGAP_chimaerin InterPro; IPR000198; RhoGAP_dom InterPro; IPR000980; SH2 InterPro; IPR036860; SH2_dom_sf Pfam; PF00130; C1_1; 1 Pfam; PF00620; RhoGAP; 1 Pfam; PF00017; SH2; 1 PIRSF; PIRSF038015; N-chimaerin; 1 PRINTS; PR00008; DAGPEDOMAIN SMART; SM00109; C1; 1 SMART; SM00324; RhoGAP; 1 SMART; SM00252; SH2; 1 SUPFAM; SSF48350; SSF48350; 1 SUPFAM; SSF55550; SSF55550; 1 PROSITE; PS50238; RHOGAP; 1 PROSITE; PS50001; SH2; 1 PROSITE; PS00479; ZF_DAG_PE_1; 1 PROSITE; PS50081; ZF_DAG_PE_2; 1 1: Evidence at protein level; 3D-structure; Alternative splicing; Complete proteome; GTPase activation; Membrane; Metal-binding; Polymorphism; Reference proteome; SH2 domain; Zinc; Zinc-finger CHAIN 1 468 Beta-chimaerin /FTId=PRO_0000056697 DOMAIN 59 127 SH2. {ECO:0000255|PROSITE- ProRule:PRU00191} DOMAIN 277 468 Rho-GAP. {ECO:0000255|PROSITE- ProRule:PRU00172} ZN_FING 214 264 Phorbol-ester/DAG-type {ECO:0000255|PROSITE-ProRule:PRU00226} VAR_SEQ 1 56 MAASSNSSLSGSSVSSDAEEYQPPIWKSYLYQLQQEAPRPK RIICPREVENRPKYY -> MFSEELWLENEKKCAVVRKSKQ GRKRQELLAVAFGVKVGVKGGFLWPPLKLFACSQ (in isoform 3, isoform 5 and isoform 7) {ECO:0000303|PubMed:14702039, ECO:0000303|Ref.3} /FTId=VSP_046271 VAR_SEQ 1 36 MAASSNSSLSGSSVSSDAEEYQPPIWKSYLYQLQQE -> M FSEELWLENEKKCAVVRKSKQGRKRQELLAVAFGV (in isoform 4 and isoform 6) {ECO:0000303|PubMed:14702039, ECO:0000303|Ref.3} /FTId=VSP_047600 VAR_SEQ 1 15 MAASSNSSLSGSSVS -> MTQTHRAKSASSCPNLLVPETW PHQVSASHAGRSKQPQGGILKINEEHRRGAIQDLLASPGFT FGKRVVFDSHCLKRQHTFADGLHSSCT (in isoform Beta-3). {ECO:0000303|Ref.4} /FTId=VSP_053679 VAR_SEQ 37 217 Missing (in isoform 4 and isoform 6) {ECO:0000303|PubMed:14702039, ECO:0000303|Ref.3} /FTId=VSP_047601 VAR_SEQ 49 192 Missing (in isoform 8) {ECO:0000303|Ref.3} /FTId=VSP_053323 VAR_SEQ 57 192 Missing (in isoform 3, isoform 5 and isoform 7). {ECO:0000303|PubMed:14702039, ECO:0000303|Ref.3} /FTId=VSP_046272 VAR_SEQ 247 304 Missing (in isoform 5) {ECO:0000303|Ref.3} /FTId=VSP_047602 VAR_SEQ 331 377 DGEKADISANVYPDINIITGALKLYFRDLPIPVITYDTYSK FIDAAK -> E (in isoform 6 and isoform 7) {ECO:0000303|Ref.3} /FTId=VSP_047603 VARIANT 204 204 H -> R (in dbSNP:rs3750103) /FTId=VAR_022118 VARIANT 438 438 P -> S (in dbSNP:rs34971642) /FTId=VAR_049136 CONFLICT 1 6 MAASSN -> MRLL (in Ref. 1; AAA16836/ AAA19191). HELIX 29 36 {ECO:0000244|PDB:1XA6} STRAND 58 63 {ECO:0000244|PDB:1XA6} HELIX 66 73 {ECO:0000244|PDB:1XA6} STRAND 79 84 {ECO:0000244|PDB:1XA6} STRAND 86 88 {ECO:0000244|PDB:1XA6} STRAND 92 98 {ECO:0000244|PDB:1XA6} STRAND 101 104 {ECO:0000244|PDB:1XA6} STRAND 108 114 {ECO:0000244|PDB:1XA6} STRAND 116 118 {ECO:0000244|PDB:1XA6} HELIX 125 138 {ECO:0000244|PDB:1XA6} HELIX 141 146 {ECO:0000244|PDB:1XA6} HELIX 153 155 {ECO:0000244|PDB:1XA6} STRAND 156 161 {ECO:0000244|PDB:1XA6} TURN 229 231 {ECO:0000244|PDB:1XA6} TURN 237 240 {ECO:0000244|PDB:1XA6} STRAND 246 248 {ECO:0000244|PDB:1XA6} HELIX 255 257 {ECO:0000244|PDB:1XA6} TURN 266 269 {ECO:0000244|PDB:1XA6} HELIX 279 286 {ECO:0000244|PDB:1XA6} HELIX 292 303 {ECO:0000244|PDB:1XA6} STRAND 306 308 {ECO:0000244|PDB:1XA6} TURN 309 313 {ECO:0000244|PDB:1XA6} HELIX 318 328 {ECO:0000244|PDB:1XA6} TURN 331 334 {ECO:0000244|PDB:1XA6} STRAND 339 342 {ECO:0000244|PDB:1XA6} HELIX 346 358 {ECO:0000244|PDB:1XA6} HELIX 369 373 {ECO:0000244|PDB:1XA6} TURN 374 377 {ECO:0000244|PDB:1XA6} HELIX 381 392 {ECO:0000244|PDB:1XA6} HELIX 397 405 {ECO:0000244|PDB:1XA6} TURN 406 410 {ECO:0000244|PDB:1XA6} HELIX 411 414 {ECO:0000244|PDB:1XA6} TURN 415 419 {ECO:0000244|PDB:1XA6} HELIX 424 431 {ECO:0000244|PDB:1XA6} TURN 432 434 {ECO:0000244|PDB:1XA6} HELIX 445 448 {ECO:0000244|PDB:1XA6} HELIX 450 462 {ECO:0000244|PDB:1XA6} HELIX 464 467 {ECO:0000244|PDB:1XA6} SEQUENCE 468 AA; 53924 MW; 63254958E0B5804C CRC64; MAASSNSSLS GSSVSSDAEE YQPPIWKSYL YQLQQEAPRP KRIICPREVE NRPKYYGREF HGIISREQAD ELLGGVEGAY ILRESQRQPG CYTLALRFGN QTLNYRLFHD GKHFVGEKRF ESIHDLVTDG LITLYIETKA AEYISKMTTN PIYEHIGYAT LLREKVSRRL SRSKNEPRKT NVTHEEHTAV EKISSLVRRA ALTHNDNHFN YEKTHNFKVH TFRGPHWCEY CANFMWGLIA QGVRCSDCGL NVHKQCSKHV PNDCQPDLKR IKKVYCCDLT TLVKAHNTQR PMVVDICIRE IEARGLKSEG LYRVSGFTEH IEDVKMAFDR DGEKADISAN VYPDINIITG ALKLYFRDLP IPVITYDTYS KFIDAAKISN ADERLEAVHE VLMLLPPAHY ETLRYLMIHL KKVTMNEKDN FMNAENLGIV FGPTLMRPPE DSTLTTLHDM RYQKLIVQIL IENEDVLF
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to
info@abgent.com, and receive a free "I Love Antibodies" mug.

Background

This antibody is expected to recognize both reported isoforms (NP_004058.1; NP_001035025.1).

References

T cell receptor-dependent tyrosine phosphorylation of beta2-chimaerin modulates its Rac-GAP function in T cells. Siliceo, M. and Merida, I. J. Biol. Chem. 284 (17), 11354-11363 (2009). PMID: 19201754

FeedBack
Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abgent.com.

$ 368.00
Cat# AF2247a
Size:
Quantity:
Availability: 7-10 days
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions
"