Register or Login
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Antibody Collections   >   Goat Antibodies   >   NEBL / nebulette Antibody (internal region)   

NEBL / nebulette Antibody (internal region)

Peptide-affinity purified goat antibody

Product Information
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
Primary Accession O76041
Other Accession NP_998734.1, NP_001166955.1, 10529, 74103 (mouse)
Predicted Human, Mouse, Dog
Host Goat
Clonality Polyclonal
Concentration 0.5 mg/ml
Isotype IgG
Additional Information
Other Names Nebulette, Actin-binding Z-disk protein, NEBL, LNEBL
Format 0.5 mg/ml in Tris saline, 0.02% sodium azide, pH7.3 with 0.5% bovine serum albumin
StorageMaintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
PrecautionsNEBL / nebulette Antibody (internal region) is for research use only and not for use in diagnostic or therapeutic procedures.
Protein Information
Synonyms LNEBL
Function Binds to actin and plays an important role in the assembly of the Z-disk. May functionally link sarcomeric actin to the desmin intermediate filaments in the heart muscle sarcomeres (PubMed:27733623). Isoform 2 might play a role in the assembly of focal adhesion (PubMed:15004028).
Cellular Location Isoform 2: Cytoplasm
Tissue Location Abundantly expressed in cardiac muscle, but not in skeletal or smooth muscle. Localized to Z-lines in cardiac cells and to dense bodies in nonmuscle cells. Isoform 2 is expressed in non-muscle cells such as in fibroblasts EMBL; Y16241; CAA76130.1; -; mRNA EMBL; Y17673; CAA76810.1; -; mRNA EMBL; AF047368; AAF24858.1; -; mRNA EMBL; AJ580772; CAE45323.1; -; mRNA EMBL; AK295186; BAG58190.1; -; mRNA EMBL; EF445000; ACA06022.1; -; Genomic_DNA EMBL; EF445000; ACA06023.1; -; Genomic_DNA EMBL; EF445000; ACA06024.1; -; Genomic_DNA EMBL; EF445000; ACA06026.1; -; Genomic_DNA EMBL; AL359175; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; AL731547; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; AL157398; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; AL158160; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; CH471072; EAW86175.1; -; Genomic_DNA EMBL; BC110453; AAI10454.1; -; mRNA EMBL; BC126132; AAI26133.1; -; mRNA EMBL; BC126134; AAI26135.1; -; mRNA CCDS; CCDS7133.1; -. [O76041-2] CCDS; CCDS7134.1; -. [O76041-1] RefSeq; NP_001166955.1; NM_001173484.1 RefSeq; NP_006384.1; NM_006393.2. [O76041-1] RefSeq; NP_998734.1; NM_213569.2. [O76041-2] UniGene; Hs.5025; - PDB; 4F14; X-ray; 1.20 A; A=955-1014 PDBsum; 4F14; - ProteinModelPortal; O76041; - SMR; O76041; - BioGrid; 115784; 32 IntAct; O76041; 34 MINT; O76041; - STRING; 9606.ENSP00000366326; - iPTMnet; O76041; - PhosphoSitePlus; O76041; - SwissPalm; O76041; - BioMuta; NEBL; - EPD; O76041; - PaxDb; O76041; - PeptideAtlas; O76041; - PRIDE; O76041; - ProteomicsDB; 50360; - ProteomicsDB; 50361; -. [O76041-2] Ensembl; ENST00000377122; ENSP00000366326; ENSG00000078114. [O76041-1] Ensembl; ENST00000417816; ENSP00000393896; ENSG00000078114. [O76041-2] GeneID; 10529; - KEGG; hsa:10529; - UCSC; uc001iqi.4; human. [O76041-1] CTD; 10529; - DisGeNET; 10529; - EuPathDB; HostDB:ENSG00000078114.18; - GeneCards; NEBL; - HGNC; HGNC:16932; NEBL HPA; HPA013994; - HPA; HPA013995; - MalaCards; NEBL; - MIM; 605491; gene neXtProt; NX_O76041; - OpenTargets; ENSG00000078114; - PharmGKB; PA134981177; - eggNOG; ENOG410IP6T; Eukaryota eggNOG; ENOG410Y1M0; LUCA GeneTree; ENSGT00530000062924; - HOGENOM; HOG000048710; - HOVERGEN; HBG006459; - InParanoid; O76041; - OMA; CTPIDEG; - OrthoDB; EOG091G0U2O; - PhylomeDB; O76041; - TreeFam; TF319104; - ChiTaRS; NEBL; human GenomeRNAi; 10529; - PRO; PR:O76041; - Proteomes; UP000005640; Chromosome 10 Bgee; ENSG00000078114; - CleanEx; HS_NEBL; - ExpressionAtlas; O76041; baseline and differential Genevisible; O76041; HS GO; GO:0070062; C:extracellular exosome; HDA:UniProtKB GO; GO:0031674; C:I band; NAS:UniProtKB GO; GO:0001725; C:stress fiber; IDA:UniProtKB GO; GO:0030018; C:Z disc; IDA:UniProtKB GO; GO:0051015; F:actin filament binding; IDA:UniProtKB GO; GO:0008092; F:cytoskeletal protein binding; IDA:UniProtKB GO; GO:0031005; F:filamin binding; IPI:UniProtKB GO; GO:0008307; F:structural constituent of muscle; NAS:UniProtKB GO; GO:0005523; F:tropomyosin binding; IPI:UniProtKB GO; GO:0071691; P:cardiac muscle thin filament assembly; IMP:UniProtKB CDD; cd11935; SH3_Nebulette_C; 1 InterPro; IPR035631; Nebulette_SH3 InterPro; IPR000900; Nebulin_repeat InterPro; IPR036028; SH3-like_dom_sf InterPro; IPR001452; SH3_domain Pfam; PF00880; Nebulin; 15 Pfam; PF14604; SH3_9; 1 PRINTS; PR00452; SH3DOMAIN SMART; SM00227; NEBU; 23 SMART; SM00326; SH3; 1 SUPFAM; SSF50044; SSF50044; 1 PROSITE; PS51216; NEBULIN; 23 PROSITE; PS50002; SH3; 1 1: Evidence at protein level; 3D-structure; Actin-binding; Alternative splicing; Complete proteome; Cytoplasm; Methylation; Polymorphism; Reference proteome; Repeat; SH3 domain CHAIN 1 1014 Nebulette /FTId=PRO_0000096774 REPEAT 29 63 Nebulin 1 REPEAT 64 99 Nebulin 2 REPEAT 100 136 Nebulin 3 REPEAT 137 172 Nebulin 4 REPEAT 173 205 Nebulin 5 REPEAT 206 241 Nebulin 6 REPEAT 242 278 Nebulin 7 REPEAT 279 313 Nebulin 8 REPEAT 314 348 Nebulin 9 REPEAT 349 385 Nebulin 10 REPEAT 386 422 Nebulin 11 REPEAT 423 459 Nebulin 12 REPEAT 460 496 Nebulin 13 REPEAT 497 533 Nebulin 14 REPEAT 534 569 Nebulin 15 REPEAT 570 599 Nebulin 16 REPEAT 600 635 Nebulin 17 REPEAT 636 666 Nebulin 18 REPEAT 667 693 Nebulin 19 REPEAT 694 728 Nebulin 20 REPEAT 729 759 Nebulin 21 REPEAT 760 794 Nebulin 22 REPEAT 795 830 Nebulin 23 DOMAIN 954 1014 SH3. {ECO:0000255|PROSITE- ProRule:PRU00192} REGION 836 953 Linker MOD_RES 795 795 Omega-N-methylarginine VAR_SEQ 1 664 Missing (in isoform 2) /FTId=VSP_043816 VAR_SEQ 665 782 TPVSMTPEIERVRRNQEQLSAVKYKGELQRGTAISDPPELK RAKENQKNISNVYYRGQLGRATTLSVTPEMERVKKNQENIS SVKYTQDHKQMKGRPSLILDTPAMRHVKEAQNHISM -> M NPQCARCGKVVYPTEKVNCLDKYWHKGCFHCEVCKMALNMN NYKGYEKKPYCNAHYPKQSFTTVADTPENLRLKQQSELQSQ VKYKRDFEESKGRGFSIVTDTPELQRLKRTQEQISN (in isoform 2). /FTId=VSP_043817 VAR_SEQ 840 920 Missing (in isoform 2) /FTId=VSP_043818 VARIANT 187 187 Q -> H (in dbSNP:rs75301590) /FTId=VAR_010289 VARIANT 219 219 A -> D (in dbSNP:rs2296610) /FTId=VAR_021887 VARIANT 351 351 M -> V (in dbSNP:rs4025981) /FTId=VAR_010290 VARIANT 378 378 D -> H (in dbSNP:rs41277370) /FTId=VAR_051229 VARIANT 654 654 N -> K (higher frequency of homozygotes in a cohort of non-familial cardiomyopathy Japanese patients as compared to healthy controls; dbSNP:rs4748728) /FTId=VAR_010291 VARIANT 728 728 T -> A (in dbSNP:rs71535732) /FTId=VAR_010292 CONFLICT 53 60 RYKEEFKK -> VIKKSLKS (in Ref. 2; AAF24858). CONFLICT 75 75 N -> T (in Ref. 2; AAF24858) CONFLICT 129 138 KHDAAKGFSD -> NMMLPRILS (in Ref. 2; AAF24858). CONFLICT 439 445 RASEMAS -> QPLKWQG (in Ref. 2; AAF24858) CONFLICT 706 726 RAKENQKNISNVYYRGQLGRA -> PKETRKTSACLLQSSA GES (in Ref. 2; AAF24858). CONFLICT 732 732 T -> I (in Ref. 2; AAF24858) CONFLICT 740 740 K -> E (in Ref. 2; AAF24858) CONFLICT 743 743 E -> G (in Ref. 2; AAF24858) CONFLICT 902 904 EIY -> RDL (in Ref. 2; AAF24858) STRAND 959 963 {ECO:0000244|PDB:4F14} STRAND 980 986 {ECO:0000244|PDB:4F14} STRAND 988 996 {ECO:0000244|PDB:4F14} TURN 997 1000 {ECO:0000244|PDB:4F14} STRAND 1001 1006 {ECO:0000244|PDB:4F14} HELIX 1007 1009 {ECO:0000244|PDB:4F14} STRAND 1010 1012 {ECO:0000244|PDB:4F14} SEQUENCE 1014 AA; 116453 MW; 81712E38BC6AC9E1 CRC64; MRVPVFEDIK DETEEEKIGE EENEEDQVFY KPVIEDLSME LARKCTELIS DIRYKEEFKK SKDKCTFVTD SPMLNHVKNI GAFISEAKYK GTIKADLSNS LYKRMPATID SVFAGEVTQL QSEVAYKQKH DAAKGFSDYA HMKEPPEVKH AMEVNKHQSN ISYRKDVQDT HTYSAELDRP DIKMATQISK IISNAEYKKG QGIMNKEPAV IGRPDFEHAV EASKLSSQIK YKEKFDNEMK DKKHHYNPLE SASFRQNQLA ATLASNVKYK KDIQNMHDPV SDLPNLLFLD HVLKASKMLS GREYKKLFEE NKGMYHFDAD AVEHLHHKGN AVLQSQVKYK EEYEKNKGKP MLEFVETPSY QASKEAQKMQ SEKVYKEDFE KEIKGRSSLD LDKTPEFLHV KYITNLLREK EYKKDLENEI KGKGMELNSE VLDIQRAKRA SEMASEKEYK KDLESIIKGK GMQAGTDTLE MQHAKKAAEI ASEKDYKRDL ETEIKGKGMQ VSTDTLDVQR AKKASEMASQ KQYKKDLENE IKGKGMQVSM DIPDILRAKR TSEIYSQRKY KDEAEKMLSN YSTIADTPEI QRIKTTQQNI SAVFYKKEVG AGTAVKDSPE IERVKKNQQN ISSVKYKEEI KHATAISDPP ELKRVKENQK NISNLQYKEQ NYKATPVSMT PEIERVRRNQ EQLSAVKYKG ELQRGTAISD PPELKRAKEN QKNISNVYYR GQLGRATTLS VTPEMERVKK NQENISSVKY TQDHKQMKGR PSLILDTPAM RHVKEAQNHI SMVKYHEDFE KTKGRGFTPV VDDPVTERVR KNTQVVSDAA YKGVHPHIVE MDRRPGIIVD LKVWRTDPGS IFDLDPLEDN IQSRSLHMLS EKASHYRRHW SRSHSSSTFG TGLGDDRSEI SEIYPSFSCC SEVTRPSDEG APVLPGAYQQ SHSQGYGYMH QTSVSSMRSM QHSPNLRTYR AMYDYSAQDE DEVSFRDGDY IVNVQPIDDG WMYGTVQRTG RTGMLPANYI EFVN
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to, and receive a free "I Love Antibodies" mug.


This antibody is expected to recognize isoform 2 and isoform 3 (NP_998734.1; NP_001166955.1) only, but does not recognize isoform 1 (NP_006384.1).


The nebulette repeat domain is necessary for proper maintenance of tropomyosin with the cardiac sarcomere. Bonzo JR, Norris AA, Esham M, Moncman CL, Exp Cell Res. 2008 Nov 15;314(19):3519-30. Epub 2008 Sep 16. PMID: 18823973

Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at

$ 358.00
Cat# AF2975a
Availability: 7-10 days
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions