Register or Login
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Antibody Collections   >   GPCR Antibodies   >   M1 Muscarinic Receptor Antibody   

M1 Muscarinic Receptor Antibody

Affinity purified rabbit polyclonal antibody

  • WB - M1 Muscarinic Receptor  Antibody AG1219-025
    Western blot analysis of rat brain membranes: 1. Anti-M1 Muscarinic Receptor antibody (#AG1219), (1:200). 2. Anti-M1 Muscarinic Receptor antibody, preincubated with the control fusion protein antigen.
  • IHC - M1 Muscarinic Receptor  Antibody AG1219-025
    Expression of M1 in rat striatum Immunohistochemical staining of rat striatum (ST) using Anti-M1 Muscarinic Receptor antibody (#AG1219). A. M1 Muscarinic Receptor appears in the striatum (green). B. Staining of interneurons with mouse anti-parvalbumin (PV, red). C. Confocal merge of M1 Muscarinic Receptor and PV demonstrates localization of PV expressing neurons in the striatal matrix; not in striatal patches (P).
  • IHC - M1 Muscarinic Receptor  Antibody AG1219-025
    Expression of M1 in mouse striatum Immunohistochemical staining of mouse striatum (ST) using Anti-M1 Muscarinic Receptor antibody (#AG1219). A. M1 Muscarinic Receptor appears in the striatum (green). B. Staining of interneurons with mouse anti-parvalbumin (PV, red). C. Confocal merge of M1 Muscarinic Receptor and PV demonstrates localization of PV expressing neurons in the striatal matrix; not in striatal patches (P).
Product Information
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
Primary Accession P11229
Reactivity Human, Mouse, Rat
Host Rabbit
Clonality Polyclonal
Calculated MW 51421 Da
Homology Macaca mulatta - 125/127 amino acid residues identical; mouse - 124/127 amino acid residues identical; pig - 124/127 amino acid residues identical; rat - 123/127 amino acid residues identical; gerbil - 123/127 amino acid residues identical.
Additional Information
Gene ID 1128
Other Names Muscarinic acetylcholine receptor M1, CHRM1
Related products for control experimentsControl peptide antigen (supplied with the antibody free of charge).
Target/Specificity GST fusion protein with a sequence GSETPGKGGGSSSSSERSQP GAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSS EGEEPGSEVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDR AGKGQKPRGKEQLAKRK, corresponding to amino acid residues 227-353 of human m1 (Accession P11229). 3rd intracellular loop.
Dilution WB~~1:200-1:2000
Peptide Confirmation Confirmed by DNA sequence and SDS-PAGE.
Format Affinity purified antibody, lyophilized powder
Reconstitution 25 µl, 50 µl or 0.2 ml deionized water, depending on the sample size.
Antibody Concentration After Reconstitution 0.95 mg/ml.
Buffer After Reconstitution Phosphate buffered saline (PBS), pH 7.4, 1% BSA, 0.05% NaN3.
Storage Before ReconstitutionLyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage After ReconstitutionThe reconstituted solution can be stored at 4ºC for up to 2 weeks. For longer periods, small aliquots should be stored at -20ºC or below. Avoid multiple freezing and thawing. The further dilutions should be made using a carrier protein such as BSA (1%). Centrifuge all antibody preparations before use (10000 × g 5 min).
Control Antigen Storage Before ReconstitutionLyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Control Antigen Reconstitution 100 µl PBS
Control Antigen Storage After Reconstitution-20ºC.
Preadsorption Control 3 µg fusion protein per 1 µg antibody.
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to, and receive a free "I Love Antibodies" mug.


The action of the neurotransmitter acetylcholine is mediated through two types of receptors, the ionotrophic nicotinic receptors and the metabotrophic muscarinic receptors. The muscarinic receptors belong to the superfamily of 7-TM G-protein-coupled receptors. Five subtypes of muscarinic receptors have been cloned and named m1-m5.1-2 The muscarinic receptors are widely distributed throughout the body, but are predominantly expressed within the parasympathetic nervous system and exerts both excitatory and inhibitory control over central and peripheral tissues.1-2 Muscarinic receptors participate in a number of physiological functions such as regulation of heart rate, muscle contraction, cognition, sensory processing and motor control.1 They also participate in learning and memory processing.3-4 The m1 receptors are the most abundant muscarinic subtype in the cortex and striatum. m1 receptors were also localized in the myenteric plexus where they function as autoreceptors to enhance the release of Ach from the nerves.5-6 The m1, m3 and m5 receptors, which are coupled to Gq/11 proteins, can protect cells from undergoing apoptosis induced by DNA damage. The signaling mechanism that mediates this anti-apoptotic response is still poorly understood. However, it was recently reported that a poly-basic motif in the C-terminus tail of the m1, m3 and m5 receptors is an essential element for the anti-apoptotic response of those receptors.7 Abgent is pleased to offer a highly specific antibody directed against the 3rd intracellular loop of the human m1 receptor. Anti-M1 Muscarinic Receptor antibody (#AG1219) can be used in Western blot analysi, immunohistochemistry and immunocytochemistry applications. It has been designed to recognize m1 from human, mouse and rat samples.


1. Felder, C.C. et al. (2000) J. Med. Chem. 43, 4333.
2. Forsythe, S.M. et al. (2002) Am. J. Respir. Cell. Mol. Biol. 26, 298.
3. Ferreira, A.R. et al. (2003) Pharmacol. Biochem. Behav. 74, 411.
4. Van der Zee, E.A. et al. (1999) Prog. Neurol. 58, 409.
5. Levey, A.I. et al. (1991) J. Neurosci. 11, 3218.
6. Wang, J. et al. (2000) Am. J. Physiol. Gastrointest. Liver Physiol. 279, G1059.
7. Budd, D.C. et al. (2003) J. Biol. Chem. 278, 19565.

Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at

$ 247.00
$ 367.00
$ 475.00
Cat# AG1219-025
Availability: 2-3 weeks
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions