Register or Login
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Neuroscience   >   Kir3.1 (GIRK1) Antibody   

Kir3.1 (GIRK1) Antibody

Affinity purified rabbit polyclonal antibody

  • WB - Kir3.1 (GIRK1) Antibody AG1411-025
    Western blot analysis of rat brain membranes: 1. Anti-Kir3.1 (GIRK1) antibody (#AG1411), (1:200). 2. Anti-Kir3.1 (GIRK1) antibody, preincubated with the control antigen.
Product Information
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
Primary Accession P63250
Reactivity Mouse, Rat
Host Rabbit
Clonality Polyclonal
Calculated MW 56573 Da
Homology Rat - identical; human - 64/66 amino acid residues identical; guinea pig - 63/66 amino acid residues identical; chicken - 59/66 amino acid residues identical.
Additional Information
Gene ID 16519
Other Names G protein-activated inward rectifier potassium channel 1, GIRK-1, Inward rectifier K(+) channel Kir31, Potassium channel, inwardly rectifying subfamily J member 3, Kcnj3, Girk1
Related products for control experimentsControl peptide antigen (supplied with the antibody free of charge).
Target/Specificity GST fusion protein with sequence LQRISSVPGNSEEKLVSKT TKMLSDPMSQSVADLPPKLQKMAGGPTRMEGNLPAKLRKM NSDRFT, corresponding to residues 437-501 of mouse GIRK1  (Accession P63250), (MW: 34 kDa.). Intracellular, C-terminus.
Dilution WB~~1:200-1:2000
Peptide Confirmation Confirmed by DNA sequence and SDS-PAGE.
Application Details Western blot analysis (WB): - Rat cardiomyocytes (See Bingen, B.O. et al. (2013) in Product Citations). Immunohistochemistry (IH): - Rat heart sections (1:20) (see Atkinson, A.J. et al. (2013) in Product Citations). - Mouse VNO neurons, also tested in KO mice (see Kim, S. et al. (2012) in Product Citations).
Format Affinity purified antibody, lyophilized powder
Reconstitution 25 µl, 50 µl or 0.2 ml deionized water, depending on the sample size.
Antibody Concentration After Reconstitution 0.6 mg/ml.
Storage Before ReconstitutionLyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage After ReconstitutionThe reconstituted solution can be stored at 4ºC for up to 2 weeks. For longer periods, small aliquots should be stored at -20ºC or below. Avoid multiple freezing and thawing. The further dilutions should be made using a carrier protein such as BSA (1%). Centrifuge all antibody preparations before use (10000 × g 5 min).
Control Antigen Storage Before ReconstitutionLyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Control Antigen Reconstitution 100 µl PBS.
Control Antigen Storage After Reconstitution-20ºC.
Preadsorption Control 3 µg fusion protein per 1 µg antibody.
Formulation Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4, 1% BSA, 0.05% NaN3.
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to, and receive a free "I Love Antibodies" mug.


Kir3.1 (or G-protein regulated Inward-Rectifier K+ channel, GIRK1) is a member of the family of inward rectifying K+ channels. The family includes 15 members that are structurally and functionally different from the voltage-dependent K+ channels. The family’s topology consists of two transmembrane domains that flank a single and highly conserved pore region with intracellular N- and C-termini. As is the case for the voltage-dependent K+ channels the functional unit for the Kir channels is composed of four subunit that can assembly as either homo or heterotetramers. Kir channels are characterized by a K+ efflux that is limited by depolarizing membrane potentials thus making them essential for controlling resting membrane potential and K+ homeostasis. Kir3.1 is a member of the Kir3.x subfamily that includes four members (Kir3.1- Kir3.4). The Kir3 family is characterized by the fact that the channels can be activated by neurotransmitters and other factors acting via the activation of G-protein coupled receptors. Binding of the corresponding ligand to the G-protein receptor induces the dissociation of Gα-GTP from the Gβγ dimer. The latter directly binds to Kir3 and activates the channel.1,3 In the heart, Kir3.1 co-assembles with Kir3.4 to form the prototypical muscarinic-gated K+ channel KAch current, responsible for slowing the heart rate in response of parasympathetic stimulation.2 In the brain, Kir3.1 co-assembles with Kir3.2 and mediates the inhibitory effects of many neurotransmitters including opioid, adrenergic, muscarinic, dopaminergic and γ-aminobutyric acid (GABA).1,3 A peptide toxin originating from the Apis mellifera bee venom, Tertiapin (#STT-250) was shown to be a potent blocker of Kir3.1 containing channels (8.6 nM for the Kir3.1/3.4 combination and 5.4 nM for the Kir3.1/3.2).4,5


1. Dascal, N. (1997) Cell Signal 9, 551.
2. Wickman, K. et al. (1998) Neuron 20, 103.
3. Mark, M.D. et al. (2000) Eur. J. Biochem. 267, 5830.
4. Jin, W. and Lu, Z. (1998) Biochemistry 37, 13291.
5. Kubo, Y. et al. (2005) Pharmacol. Rev. 57, 509.

Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at

$ 247.00
$ 367.00
$ 475.00
Cat# AG1411-025
Availability: 2-3 weeks
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions