Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Antibody Collections   >   Zebrafish   >   LBX1 antibody - middle region   

LBX1 antibody - middle region

Rabbit Polyclonal Antibody

     
  • WB - LBX1 antibody - middle region AI10071
    LBX1 antibody - middle region (AI10071) in Hum. Fetal Muscle cells using Western Blot
    Host: Rabbit
    Target Name: LBX1
    Sample Tissue: Human Fetal Muscle
    Antibody Dilution: 1.0μg/ml
  • WB - LBX1 antibody - middle region AI10071
    LBX1 antibody - middle region (AI10071) in Human NCI-H226 cells using Western Blot
    Host: Rabbit
    Target Name: LBX1
    Sample Tissue: NCI-H226
    Antibody Dilution: 1.0μg/mlLBX1 is supported by BioGPS gene expression data to be expressed in NCIH226
  • WB - LBX1 antibody - middle region AI10071
    LBX1 antibody - middle region (AI10071) in Human Thymus cells using Western Blot
    WB Suggested Anti-LBX1 Antibody Titration: 0.2-1 μg/ml
    ELISA Titer: 1:1562500
    Positive Control: Human Thymus
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
WB
Primary Accession P52954
Other Accession P52954, NP_006553, NM_006562
Reactivity Human, Mouse, Rat, Rabbit, Zebrafish, Pig, Dog, Guinea Pig, Horse, Bovine
Predicted Human, Mouse, Rat, Rabbit, Zebrafish, Pig, Chicken, Dog, Guinea Pig, Bovine
Host Rabbit
Clonality Polyclonal
Calculated MW 30 kDa
Additional Information
Alias Symbol HPX-6, HPX6, LBX1H, homeobox
Other Names Transcription factor LBX1, Ladybird homeobox protein homolog 1, LBX1, LBX1H
Target/Specificity LBX1 is the transcription factor required for the development of GABAergic interneurons in the dorsal horn of the spinal cord and migration and further development of hypaxial muscle precursor cells for limb muscles, diaphragm and hypoglossal cord.This gene and the orthologous mouse gene were found by their homology to the Drosophila lady bird early and late homeobox genes. In the mouse, this gene is a key regulator of muscle precursor cell migration and is required for the acquisition of dorsal identities of forelimb muscles.
Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution & Storage Add 50 ul of distilled water. Final anti-LBX1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
PrecautionsLBX1 antibody - middle region is for research use only and not for use in diagnostic or therapeutic procedures.
Protein Information
Name LBX1
Synonyms LBX1H
Function Transcription factor required for the development of GABAergic interneurons in the dorsal horn of the spinal cord and migration and further development of hypaxial muscle precursor cells for limb muscles, diaphragm and hypoglossal cord.
Cellular Location Nucleus. EMBL; X90828; CAA62342.1; -; mRNA EMBL; AL135794; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; CH471066; EAW49777.1; -; Genomic_DNA EMBL; BC069156; AAH69156.1; -; mRNA EMBL; BC136321; AAI36322.1; -; mRNA CCDS; CCDS31270.1; - RefSeq; NP_006553.2; NM_006562.4 UniGene; Hs.37128; - ProteinModelPortal; P52954; - SMR; P52954; - BioGrid; 115903; 1 IntAct; P52954; 23 STRING; 9606.ENSP00000359212; - iPTMnet; P52954; - PhosphoSitePlus; P52954; - BioMuta; LBX1; - DMDM; 117949813; - PaxDb; P52954; - PeptideAtlas; P52954; - PRIDE; P52954; - ProteomicsDB; 56564; - Ensembl; ENST00000370193; ENSP00000359212; ENSG00000138136 GeneID; 10660; - KEGG; hsa:10660; - UCSC; uc001ksx.4; human CTD; 10660; - DisGeNET; 10660; - EuPathDB; HostDB:ENSG00000138136.6; - GeneCards; LBX1; - HGNC; HGNC:16960; LBX1 HPA; HPA002016; - HPA; HPA002086; - MIM; 604255; gene neXtProt; NX_P52954; - OpenTargets; ENSG00000138136; - PharmGKB; PA142671561; - eggNOG; KOG0488; Eukaryota eggNOG; ENOG411188D; LUCA GeneTree; ENSGT00910000143996; - HOGENOM; HOG000007247; - HOVERGEN; HBG006244; - InParanoid; P52954; - KO; K09353; - OMA; HTTSKEC; - OrthoDB; EOG091G09CY; - PhylomeDB; P52954; - TreeFam; TF325047; - SIGNOR; P52954; - GeneWiki; LBX1; - GenomeRNAi; 10660; - PRO; PR:P52954; - Proteomes; UP000005640; Chromosome 10 Bgee; ENSG00000138136; - CleanEx; HS_LBX1; - Genevisible; P52954; HS GO; GO:0005634; C:nucleus; IEA:UniProtKB-SubCell GO; GO:0005667; C:transcription factor complex; IEA:Ensembl GO; GO:0000981; F:RNA polymerase II transcription factor activity, sequence-specific DNA binding; ISA:NTNU_SB GO; GO:0043565; F:sequence-specific DNA binding; IEA:InterPro GO; GO:0009653; P:anatomical structure morphogenesis; TAS:ProtInc GO; GO:0001947; P:heart looping; IEA:Ensembl GO; GO:0007517; P:muscle organ development; IEA:UniProtKB-KW GO; GO:0008285; P:negative regulation of cell proliferation; IEA:Ensembl GO; GO:0045665; P:negative regulation of neuron differentiation; IEA:Ensembl GO; GO:0048664; P:neuron fate determination; IEA:Ensembl GO; GO:0021920; P:regulation of transcription from RNA polymerase II promoter involved in spinal cord association neuron specification; IEA:Ensembl GO; GO:0021522; P:spinal cord motor neuron differentiation; IEA:Ensembl GO; GO:0006351; P:transcription, DNA-templated; IEA:UniProtKB-KW CDD; cd00086; homeodomain; 1 InterPro; IPR009057; Homeobox-like_sf InterPro; IPR017970; Homeobox_CS InterPro; IPR001356; Homeobox_dom InterPro; IPR000047; HTH_motif Pfam; PF00046; Homeobox; 1 PRINTS; PR00031; HTHREPRESSR SMART; SM00389; HOX; 1 SUPFAM; SSF46689; SSF46689; 1 PROSITE; PS00027; HOMEOBOX_1; 1 PROSITE; PS50071; HOMEOBOX_2; 1 2: Evidence at transcript level; Complete proteome; Developmental protein; Differentiation; DNA-binding; Homeobox; Myogenesis; Neurogenesis; Nucleus; Reference proteome; Transcription; Transcription regulation CHAIN 1 281 Transcription factor LBX1 /FTId=PRO_0000049166 DNA_BIND 125 184 Homeobox. {ECO:0000255|PROSITE- ProRule:PRU00108} COMPBIAS 220 226 Poly-Gly COMPBIAS 270 281 Asp/Glu-rich (highly acidic) CONFLICT 33 72 LTPFSIEDILNKPSVRRSYSLCGAAHLLAAADKHAQGGLP -> YAVQHRGHPQQAVRAEKLLAAWGGAPAGRRGQARAGRL A (in Ref. 1; CAA62342). CONFLICT 81 81 Q -> K (in Ref. 1; CAA62342) CONFLICT 183 183 D -> E (in Ref. 1; CAA62342) CONFLICT 194 194 A -> P (in Ref. 1; CAA62342) CONFLICT 247 248 AG -> RC (in Ref. 1; CAA62342) SEQUENCE 281 AA; 30221 MW; 8467F2B515681CCA CRC64; MTSKEDGKAA PGEERRRSPL DHLPPPANSN KPLTPFSIED ILNKPSVRRS YSLCGAAHLL AAADKHAQGG LPLAGRALLS QTSPLCALEE LASKTFKGLE VSVLQAAEGR DGMTIFGQRQ TPKKRRKSRT AFTNHQIYEL EKRFLYQKYL SPADRDQIAQ QLGLTNAQVI TWFQNRRAKL KRDLEEMKAD VESAKKLGPS GQMDIVALAE LEQNSEATAG GGGGCGRAKS RPGSPVLPPG APKAPGAGAL QLSPASPLTD QPASSQDCSE DEEDEEIDVD D
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to
info@abgent.com, and receive a free "I Love Antibodies" mug.

Background

This is a rabbit polyclonal antibody against LBX1. It was validated on Western Blot using a cell lysate as a positive control. Abgent strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (sales@abgent.com).

FeedBack
Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abgent.com.

$ 295.00
Cat# AI10071
Size:
Quantity:
Availability: 2-3 days
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions
"