Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Immunology   >   ZFAT1 antibody - middle region   

ZFAT1 antibody - middle region

Rabbit Polyclonal Antibody

     
  • WB - ZFAT1 antibody - middle region AI10444
    WB Suggested Anti-ZFAT1 Antibody Titration: .2-1 μg/ml
    ELISA Titer: 1:3125
    Positive Control: Human Muscle
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
WB
Primary Accession Q9P243
Other Accession NM_001029939, NP_001025110
Reactivity Human, Mouse, Rat, Horse, Bovine, Dog
Predicted Human, Mouse, Dog
Host Rabbit
Clonality Polyclonal
Calculated MW 94kDa
Additional Information
Alias Symbol AITD3, KIAA1485, MGC126815, MGC126817, ZFAT, ZNF406, ZFAT1
Other Names Zinc finger protein ZFAT, Zinc finger gene in AITD susceptibility region, Zinc finger protein 406, ZFAT, KIAA1485, ZFAT1, ZNF406
Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution & Storage Add 50 ul of distilled water. Final anti-ZFAT1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at 20°C. Avoid repeat freeze-thaw cycles.
PrecautionsZFAT1 antibody - middle region is for research use only and not for use in diagnostic or therapeutic procedures.
Protein Information
Name ZFAT
Synonyms KIAA1485, ZFAT1, ZNF406
Function May be involved in transcriptional regulation. Overexpression causes down-regulation of a number of genes involved in the immune response. Some genes are also up-regulated (By similarity).
Cellular Location Nucleus. Cytoplasm, cytosol
Tissue Location Isoform 1 is strongly expressed in placenta, spleen, kidney, testis and peripheral blood leukocytes. Expressed in CD4+ and CD8+ T-cells, CD19+ B-cells and CB14+ monocytes Isoform 3 is strongly expressed in placenta, ovary, tonsil, CD19+ B-cells and CD14+ monocytes. EMBL; AB167738; BAD12567.1; -; mRNA EMBL; AB167739; BAD12568.1; -; mRNA EMBL; AB167740; BAD12569.1; -; mRNA EMBL; AB167741; BAD12570.1; -; mRNA EMBL; AC015599; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; AC087045; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; AC135075; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; BC025423; AAH25423.1; -; mRNA EMBL; BC046180; AAH46180.1; -; mRNA EMBL; BC101766; AAI01767.1; -; mRNA EMBL; BC101768; AAI01769.1; -; mRNA EMBL; BC143519; AAI43520.1; -; mRNA EMBL; AB040918; BAA96009.1; -; mRNA CCDS; CCDS43768.2; -. [Q9P243-2] CCDS; CCDS47924.1; -. [Q9P243-1] CCDS; CCDS55276.1; -. [Q9P243-4] RefSeq; NP_001025110.2; NM_001029939.3. [Q9P243-2] RefSeq; NP_001167628.1; NM_001174157.1. [Q9P243-4] RefSeq; NP_001276323.1; NM_001289394.1. [Q9P243-2] RefSeq; NP_065914.2; NM_020863.3. [Q9P243-1] RefSeq; XP_011515505.1; XM_011517203.1. [Q9P243-2] UniGene; Hs.446172; - PDB; 2ELM; NMR; -; A=768-797 PDB; 2ELN; NMR; -; A=796-826 PDB; 2ELO; NMR; -; A=828-857 PDB; 2ELP; NMR; -; A=878-907 PDB; 2ELQ; NMR; -; A=907-935 PDB; 2ELR; NMR; -; A=935-963 PDB; 2ELS; NMR; -; A=269-297 PDB; 2ELT; NMR; -; A=297-325 PDB; 2ELU; NMR; -; A=352-381 PDB; 2ELV; NMR; -; A=402-430 PDB; 2RSH; NMR; -; A=324-353 PDB; 2RSI; NMR; -; A=297-381 PDB; 2RSJ; NMR; -; A=269-353 PDB; 2RUT; NMR; -; A=269-297 PDB; 2RUU; NMR; -; A=297-325 PDB; 2RUV; NMR; -; A=323-353 PDB; 2RUW; NMR; -; A=352-381 PDB; 2RUX; NMR; -; A=402-430 PDB; 2RUY; NMR; -; A=768-797 PDB; 2RUZ; NMR; -; A=796-826 PDB; 2RV0; NMR; -; A=828-857 PDB; 2RV1; NMR; -; A=878-907 PDB; 2RV2; NMR; -; A=907-935 PDB; 2RV3; NMR; -; A=935-963 PDB; 2RV6; NMR; -; A=269-353 PDB; 2RV7; NMR; -; A=297-381 PDBsum; 2ELM; - PDBsum; 2ELN; - PDBsum; 2ELO; - PDBsum; 2ELP; - PDBsum; 2ELQ; - PDBsum; 2ELR; - PDBsum; 2ELS; - PDBsum; 2ELT; - PDBsum; 2ELU; - PDBsum; 2ELV; - PDBsum; 2RSH; - PDBsum; 2RSI; - PDBsum; 2RSJ; - PDBsum; 2RUT; - PDBsum; 2RUU; - PDBsum; 2RUV; - PDBsum; 2RUW; - PDBsum; 2RUX; - PDBsum; 2RUY; - PDBsum; 2RUZ; - PDBsum; 2RV0; - PDBsum; 2RV1; - PDBsum; 2RV2; - PDBsum; 2RV3; - PDBsum; 2RV6; - PDBsum; 2RV7; - ProteinModelPortal; Q9P243; - SMR; Q9P243; - BioGrid; 121669; 3 IntAct; Q9P243; 3 STRING; 9606.ENSP00000367069; - iPTMnet; Q9P243; - PhosphoSitePlus; Q9P243; - BioMuta; ZFAT; - DMDM; 85681862; - EPD; Q9P243; - MaxQB; Q9P243; - PaxDb; Q9P243; - PeptideAtlas; Q9P243; - PRIDE; Q9P243; - ProteomicsDB; 83726; - ProteomicsDB; 83727; -. [Q9P243-2] ProteomicsDB; 83728; -. [Q9P243-3] Ensembl; ENST00000377838; ENSP00000367069; ENSG00000066827. [Q9P243-1] Ensembl; ENST00000520214; ENSP00000428483; ENSG00000066827. [Q9P243-2] Ensembl; ENST00000520727; ENSP00000427831; ENSG00000066827. [Q9P243-2] Ensembl; ENST00000523399; ENSP00000429091; ENSG00000066827. [Q9P243-4] GeneID; 57623; - KEGG; hsa:57623; - UCSC; uc003yun.4; human. [Q9P243-1] CTD; 57623; - DisGeNET; 57623; - EuPathDB; HostDB:ENSG00000066827.15; - GeneCards; ZFAT; - HGNC; HGNC:19899; ZFAT HPA; HPA020989; - HPA; HPA063592; - MalaCards; ZFAT; - MIM; 610931; gene neXtProt; NX_Q9P243; - OpenTargets; ENSG00000066827; - PharmGKB; PA162409638; - eggNOG; KOG1721; Eukaryota eggNOG; COG5048; LUCA GeneTree; ENSGT00920000149106; - HOGENOM; HOG000155776; - HOVERGEN; HBG065928; - InParanoid; Q9P243; - OMA; KRQLLYD; - OrthoDB; EOG091G00PE; - PhylomeDB; Q9P243; - TreeFam; TF350017; - ChiTaRS; ZFAT; human EvolutionaryTrace; Q9P243; - GenomeRNAi; 57623; - PRO; PR:Q9P243; - Proteomes; UP000005640; Chromosome 8 Bgee; ENSG00000066827; - CleanEx; HS_ZFAT; - ExpressionAtlas; Q9P243; baseline and differential Genevisible; Q9P243; HS GO; GO:0005829; C:cytosol; IEA:UniProtKB-SubCell GO; GO:0005634; C:nucleus; IEA:UniProtKB-SubCell GO; GO:0003677; F:DNA binding; IEA:UniProtKB-KW GO; GO:0046872; F:metal ion binding; IEA:UniProtKB-KW GO; GO:0000981; F:RNA polymerase II transcription factor activity, sequence-specific DNA binding; ISA:NTNU_SB GO; GO:0001077; F:transcriptional activator activity, RNA polymerase II proximal promoter sequence-specific DNA binding; IEA:Ensembl GO; GO:0002244; P:hematopoietic progenitor cell differentiation; IEA:Ensembl GO; GO:0060712; P:spongiotrophoblast layer development; IEA:Ensembl InterPro; IPR036236; Znf_C2H2_sf InterPro; IPR013087; Znf_C2H2_type SMART; SM00355; ZnF_C2H2; 19 SUPFAM; SSF57667; SSF57667; 8 PROSITE; PS00028; ZINC_FINGER_C2H2_1; 10 PROSITE; PS50157; ZINC_FINGER_C2H2_2; 13 1: Evidence at protein level; 3D-structure; Alternative splicing; Complete proteome; Cytoplasm; DNA-binding; Metal-binding; Nucleus; Polymorphism; Reference proteome; Repeat; Transcription; Transcription regulation; Zinc; Zinc-finger CHAIN 1 1243 Zinc finger protein ZFAT /FTId=PRO_0000047566 ZN_FING 12 35 C2H2-type 1. {ECO:0000255|PROSITE- ProRule:PRU00042} ZN_FING 116 141 C2H2-type 2; degenerate {ECO:0000255|PROSITE-ProRule:PRU00042} ZN_FING 271 293 C2H2-type 3. {ECO:0000255|PROSITE- ProRule:PRU00042} ZN_FING 299 321 C2H2-type 4. {ECO:0000255|PROSITE- ProRule:PRU00042} ZN_FING 326 349 C2H2-type 5. {ECO:0000255|PROSITE- ProRule:PRU00042} ZN_FING 354 377 C2H2-type 6. {ECO:0000255|PROSITE- ProRule:PRU00042} ZN_FING 404 426 C2H2-type 7. {ECO:0000255|PROSITE- ProRule:PRU00042} ZN_FING 432 454 C2H2-type 8. {ECO:0000255|PROSITE- ProRule:PRU00042} ZN_FING 458 481 C2H2-type 9. {ECO:0000255|PROSITE- ProRule:PRU00042} ZN_FING 742 764 C2H2-type 10. {ECO:0000255|PROSITE- ProRule:PRU00042} ZN_FING 770 793 C2H2-type 11. {ECO:0000255|PROSITE- ProRule:PRU00042} ZN_FING 798 822 C2H2-type 12. {ECO:0000255|PROSITE- ProRule:PRU00042} ZN_FING 830 853 C2H2-type 13. {ECO:0000255|PROSITE- ProRule:PRU00042} ZN_FING 880 903 C2H2-type 14; degenerate {ECO:0000255|PROSITE-ProRule:PRU00042} ZN_FING 909 931 C2H2-type 15. {ECO:0000255|PROSITE- ProRule:PRU00042} ZN_FING 937 959 C2H2-type 16. {ECO:0000255|PROSITE- ProRule:PRU00042} ZN_FING 966 988 C2H2-type 17. {ECO:0000255|PROSITE- ProRule:PRU00042} ZN_FING 994 1017 C2H2-type 18. {ECO:0000255|PROSITE- ProRule:PRU00042} ZN_FING 1041 1064 C2H2-type 19. {ECO:0000255|PROSITE- ProRule:PRU00042} VAR_SEQ 1 12 Missing (in isoform 2 and isoform 3) /FTId=VSP_016959 VAR_SEQ 150 211 Missing (in isoform 4) /FTId=VSP_045461 VAR_SEQ 826 858 DKRSYSCPVCEKSFSEDRLIKSHIKTNHPEVSM -> VSSK PKRQPRLPWVLIAFSSLCLYVGVSAAGQP (in isoform 3). /FTId=VSP_034938 VAR_SEQ 859 1243 Missing (in isoform 3) /FTId=VSP_034939 VARIANT 64 64 G -> R (in dbSNP:rs17778003) /FTId=VAR_024840 VARIANT 102 102 P -> S (in dbSNP:rs12541381) /FTId=VAR_045815 VARIANT 672 672 R -> K (in dbSNP:rs35003767) /FTId=VAR_052819 TURN 274 276 {ECO:0000244|PDB:2ELS} STRAND 279 282 {ECO:0000244|PDB:2ELS} HELIX 283 293 {ECO:0000244|PDB:2ELS} STRAND 298 300 {ECO:0000244|PDB:2ELT} STRAND 302 305 {ECO:0000244|PDB:2ELT} STRAND 307 310 {ECO:0000244|PDB:2ELT} HELIX 311 321 {ECO:0000244|PDB:2ELT} STRAND 329 331 {ECO:0000244|PDB:2RSH} STRAND 334 336 {ECO:0000244|PDB:2RSI} HELIX 338 347 {ECO:0000244|PDB:2RSH} TURN 357 359 {ECO:0000244|PDB:2ELU} STRAND 362 365 {ECO:0000244|PDB:2RSI} HELIX 366 375 {ECO:0000244|PDB:2ELU} STRAND 407 409 {ECO:0000244|PDB:2ELV} STRAND 412 415 {ECO:0000244|PDB:2ELV} HELIX 416 423 {ECO:0000244|PDB:2ELV} TURN 424 426 {ECO:0000244|PDB:2ELV} STRAND 769 771 {ECO:0000244|PDB:2ELM} STRAND 773 776 {ECO:0000244|PDB:2ELM} STRAND 778 780 {ECO:0000244|PDB:2ELM} HELIX 782 792 {ECO:0000244|PDB:2ELM} STRAND 801 804 {ECO:0000244|PDB:2ELN} STRAND 808 810 {ECO:0000244|PDB:2ELN} HELIX 812 822 {ECO:0000244|PDB:2ELN} TURN 833 836 {ECO:0000244|PDB:2ELO} STRAND 838 841 {ECO:0000244|PDB:2RV0} HELIX 842 852 {ECO:0000244|PDB:2ELO} HELIX 854 856 {ECO:0000244|PDB:2RV0} STRAND 883 886 {ECO:0000244|PDB:2ELP} HELIX 894 904 {ECO:0000244|PDB:2ELP} STRAND 908 910 {ECO:0000244|PDB:2ELQ} STRAND 912 915 {ECO:0000244|PDB:2ELQ} STRAND 917 919 {ECO:0000244|PDB:2ELQ} HELIX 921 930 {ECO:0000244|PDB:2ELQ} TURN 940 942 {ECO:0000244|PDB:2ELR} STRAND 945 948 {ECO:0000244|PDB:2RV3} HELIX 949 959 {ECO:0000244|PDB:2ELR} SEQUENCE 1243 AA; 139034 MW; AF3E5339ED38D91C CRC64; METRAAENTA IFMCKCCNLF SPNQSELLSH VSEKHMEEGV NVDEIIIPLR PLSTPEPPNS SKTGDEFLVM KRKRGRPKGS TKKSSTEEEL AENIVSPTED SPLAPEEGNS LPPSSLECSK CCRKFSNTRQ LRKHICIIVL NLGEEEGEAG NESDLELEKK CKEDDREKAS KRPRSQKTEK VQKISGKEAR QLSGAKKPII SVVLTAHEAI PGATKIVPVE AGPPETGATN SETTSADLVP RRGYQEYAIQ QTPYEQPMKS SRLGPTQLKI FTCEYCNKVF KFKHSLQAHL RIHTNEKPYK CPQCSYASAI KANLNVHLRK HTGEKFACDY CSFTCLSKGH LKVHIERVHK KIKQHCRFCK KKYSDVKNLI KHIRDAHDPQ DKKVKEALDE LCLMTREGKR QLLYDCHICE RKFKNELDRD RHMLVHGDKW PFACELCGHG ATKYQALELH VRKHPFVYVC AVCRKKFVSS IRLRTHIKEV HGAAQEALVF TSSINQSFCL LEPGGDIQQE ALGDQLQLVE EEFALQGVNA LKEEACPGDT QLEEGRKEPE APGEMPAPAV HLASPQAEST ALPPCELETT VVSSSDLHSQ EVVSDDFLLK NDTSSAEAHA APEKPPDMQH RSSVQTQGEV ITLLLSKAQS AGSDQESHGA QSPLGEGQNM AVLSAGDPDP SRCLRSNPAE ASDLLPPVAG GGDTITHQPD SCKAAPEHRS GITAFMKVLN SLQKKQMNTS LCERIRKVYG DLECEYCGKL FWYQVHFDMH VRTHTREHLY YCSQCHYSSI TKNCLKRHVI QKHSNILLKC PTDGCDYSTP DKYKLQAHLK VHTALDKRSY SCPVCEKSFS EDRLIKSHIK TNHPEVSMST ISEVLGRRVQ LKGLIGKRAM KCPYCDFYFM KNGSDLQRHI WAHEGVKPFK CSLCEYATRS KSNLKAHMNR HSTEKTHLCD MCGKKFKSKG TLKSHKLLHT ADGKQFKCTV CDYTAAQKPQ LLRHMEQHVS FKPFRCAHCH YSCNISGSLK RHYNRKHPNE EYANVGTGEL AAEVLIQQGG LKCPVCSFVY GTKWEFNRHL KNKHGLKVVE IDGDPKWETA TEAPEEPSTQ YLHITEAEED VQGTQAAVAA LQDLRYTSES GDRLDPTAVN ILQQIIELGA ETHDATALAS VVAMAPGTVT VVKQVTEEEP SSNHTVMIQE TVQQASVELA EQHHLVVSSD DVEGIETVTV YTQGGEASEF IVYVQEAMQP VEEQAVEQPA QEL
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to
info@abgent.com, and receive a free "I Love Antibodies" mug.

References

Koyanagi,M., (2008) Genomics 91 (5), 451-457 Reconstitution and Storage:For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

FeedBack
Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abgent.com.

$ 295.00
Cat# AI10444
Size:
Quantity:
Availability: 2-3 days
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions
"