Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Antibody Collections   >   Zebrafish   >   CRIP2 antibody - middle region   

CRIP2 antibody - middle region

Rabbit Polyclonal Antibody

     
  • WB - CRIP2 antibody - middle region AI10638
    WB Suggested Anti-CRIP2 Antibody Titration: .2-1 μg/ml
    ELISA Titer: 1:3125
    Positive Control: MCF7 cell lysate

    CRIP2 is supported by BioGPS gene expression data to be expressed in MCF7

  • IHC - CRIP2 antibody - middle region AI10638
    Rabbit Anti-CRIP2 Antibody

    Catalog Number: AI1638

    Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue
    Observed Staining: Cytoplasmic in alveolar type I cells

    Primary Antibody
    Concentration: 1:1
    Other Working Concentrations: 1/6

    Secondary Antibody: Donkey anti-Rabbit-Cy3

    Secondary Antibody
    Concentration: 1:2

    Magnification: 2X

    Exposure Time: .5 - 2. sec
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
WB, IHC
Primary Accession P52943
Other Accession NM_001312, NP_001303
Reactivity Human, Mouse, Rat, Zebrafish, Horse, Bovine, Dog
Predicted Human, Mouse, Rat, Zebrafish, Bovine, Dog
Host Rabbit
Clonality Polyclonal
Calculated MW 22kDa
Additional Information
Alias Symbol CRIP, CRP2, ESP1
Other Names Cysteine-rich protein 2, CRP-2, Protein ESP1, CRIP2, CRP2
Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution & Storage Add 50 ul of distilled water. Final anti-CRIP2 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at 20°C. Avoid repeat freeze-thaw cycles.
PrecautionsCRIP2 antibody - middle region is for research use only and not for use in diagnostic or therapeutic procedures.
Protein Information
Name CRIP2
Synonyms CRP2
Tissue Location Widespread tissue expression; highest levels in the heart EMBL; D42123; BAA07703.1; -; mRNA EMBL; U36190; AAB03194.1; -; mRNA EMBL; BT019911; AAV38714.1; -; mRNA EMBL; AK300092; BAH13206.1; -; mRNA EMBL; AK315757; BAG38110.1; -; mRNA EMBL; AL928654; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; BC000434; AAH00434.1; -; mRNA EMBL; BC001931; AAH01931.1; -; mRNA EMBL; BC034151; AAH34151.1; -; mRNA EMBL; BC128101; AAI28102.1; -; mRNA CCDS; CCDS10003.1; -. [P52943-1] CCDS; CCDS59246.1; -. [P52943-2] PIR; G02090; G02090 RefSeq; NP_001257766.1; NM_001270837.1. [P52943-2] RefSeq; NP_001257770.1; NM_001270841.1 RefSeq; NP_001303.1; NM_001312.3. [P52943-1] UniGene; Hs.534309; - PDB; 2CU8; NMR; -; A=1-63 PDBsum; 2CU8; - ProteinModelPortal; P52943; - SMR; P52943; - BioGrid; 107787; 18 DIP; DIP-49905N; - IntAct; P52943; 15 MINT; P52943; - iPTMnet; P52943; - PhosphoSitePlus; P52943; - DMDM; 1706133; - EPD; P52943; - MaxQB; P52943; - PaxDb; P52943; - PeptideAtlas; P52943; - PRIDE; P52943; - ProteomicsDB; 56553; - DNASU; 1397; - Ensembl; ENST00000329146; ENSP00000328521; ENSG00000182809. [P52943-1] Ensembl; ENST00000483017; ENSP00000426119; ENSG00000182809. [P52943-2] GeneID; 1397; - KEGG; hsa:1397; - UCSC; uc001yrd.3; human. [P52943-1] CTD; 1397; - DisGeNET; 1397; - EuPathDB; HostDB:ENSG00000182809.10; - GeneCards; CRIP2; - HGNC; HGNC:2361; CRIP2 HPA; HPA042664; - MIM; 601183; gene neXtProt; NX_P52943; - OpenTargets; ENSG00000182809; - PharmGKB; PA26879; - eggNOG; ENOG410KDR6; Eukaryota eggNOG; ENOG410XUEW; LUCA GeneTree; ENSGT00550000074548; - HOGENOM; HOG000111234; - HOVERGEN; HBG051143; - InParanoid; P52943; - OMA; SYIYDKP; - OrthoDB; EOG091G11RX; - PhylomeDB; P52943; - TreeFam; TF313758; - SIGNOR; P52943; - ChiTaRS; CRIP2; human EvolutionaryTrace; P52943; - GeneWiki; CRIP2; - GenomeRNAi; 1397; - PRO; PR:P52943; - Proteomes; UP000005640; Chromosome 14 Bgee; ENSG00000182809; - CleanEx; HS_CRIP2; - ExpressionAtlas; P52943; baseline and differential Genevisible; P52943; HS GO; GO:0005938; C:cell cortex; IEA:Ensembl GO; GO:0008270; F:zinc ion binding; TAS:ProtInc GO; GO:0030097; P:hemopoiesis; IEA:Ensembl GO; GO:0008284; P:positive regulation of cell proliferation; IEA:Ensembl InterPro; IPR001781; Znf_LIM Pfam; PF00412; LIM; 2 SMART; SM00132; LIM; 2 PROSITE; PS00478; LIM_DOMAIN_1; 2 PROSITE; PS50023; LIM_DOMAIN_2; 2 1: Evidence at protein level; 3D-structure; Acetylation; Alternative splicing; Complete proteome; LIM domain; Metal-binding; Phosphoprotein; Reference proteome; Repeat; Zinc CHAIN 1 208 Cysteine-rich protein 2 /FTId=PRO_0000075710 DOMAIN 5 57 LIM zinc-binding 1. {ECO:0000255|PROSITE- ProRule:PRU00125} DOMAIN 126 178 LIM zinc-binding 2. {ECO:0000255|PROSITE- ProRule:PRU00125} COMPBIAS 63 73 Gly-rich COMPBIAS 180 194 Gly-rich MOD_RES 23 23 N6-acetyllysine {ECO:0000250|UniProtKB:Q9DCT8} MOD_RES 104 104 Phosphoserine MOD_RES 138 138 N6-acetyllysine MOD_RES 144 144 N6-acetyllysine {ECO:0000250|UniProtKB:Q9DCT8} VAR_SEQ 1 14 MASKCPKCDKTVYF -> MPPHHLLPWLAQVPSAEGELVRL VSRAGGRGACFWPAVTMEMAVAAGCVCKGGGCCHREPSQDH HESQEHRGPLVGSQTCLVHQAEGT (in isoform 2) /FTId=VSP_047074 TURN 6 8 {ECO:0000244|PDB:2CU8} TURN 14 16 {ECO:0000244|PDB:2CU8} STRAND 17 20 {ECO:0000244|PDB:2CU8} STRAND 23 26 {ECO:0000244|PDB:2CU8} TURN 27 29 {ECO:0000244|PDB:2CU8} STRAND 33 35 {ECO:0000244|PDB:2CU8} STRAND 45 47 {ECO:0000244|PDB:2CU8} STRAND 50 52 {ECO:0000244|PDB:2CU8} TURN 54 56 {ECO:0000244|PDB:2CU8} HELIX 57 61 {ECO:0000244|PDB:2CU8} SEQUENCE 208 AA; 22493 MW; D32B99F98D51D3B0 CRC64; MASKCPKCDK TVYFAEKVSS LGKDWHKFCL KCERCSKTLT PGGHAEHDGK PFCHKPCYAT LFGPKGVNIG GAGSYIYEKP LAEGPQVTGP IEVPAARAEE RKASGPPKGP SRASSVTTFT GEPNTCPRCS KKVYFAEKVT SLGKDWHRPC LRCERCGKTL TPGGHAEHDG QPYCHKPCYG ILFGPKGVNT GAVGSYIYDR DPEGKVQP
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to
info@abgent.com, and receive a free "I Love Antibodies" mug.

References

Lim,J., (2006) Cell 125 (4), 801-814 Reconstitution and Storage:For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

FeedBack
Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abgent.com.

$ 295.00
Cat# AI10638
Size:
Quantity:
Availability: 2-3 days
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions
"