Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Lcorl antibody - middle region   

Lcorl antibody - middle region

Rabbit Polyclonal Antibody

     
  • WB - Lcorl antibody - middle region AI11679

    WB Suggested Anti-Lcorl Antibody Titration: 0.2-1 μg/ml
    Positive Control: Mouse Kidney
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
WB
Primary Accession Q3U285
Other Accession NM_172153, NP_742165
Reactivity Human, Mouse, Rat, Rabbit, Pig, Horse, Bovine, Dog
Predicted Human, Mouse, Rabbit, Pig, Chicken, Horse, Bovine, Dog
Host Rabbit
Clonality Polyclonal
Calculated MW 57kDa
Additional Information
Alias Symbol Mlr1
Other Names Ligand-dependent nuclear receptor corepressor-like protein, LCoR-like protein, Mblk1-related protein 1, Transcription factor MLR1, Lcorl, Mlr1
Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution & Storage Add 50 ul of distilled water. Final anti-Lcorl antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at 20°C. Avoid repeat freeze-thaw cycles.
PrecautionsLcorl antibody - middle region is for research use only and not for use in diagnostic or therapeutic procedures.
Protein Information
Name Lcorl
Synonyms Mlr1
Function May act as transcription activator that binds DNA elements with the sequence 5'-CCCTATCGATCGATCTCTACCT-3'. May play a role in spermatogenesis.
Cellular Location Nucleus {ECO:0000255|PROSITE- ProRule:PRU00320}
Tissue Location Expressed predominantly in the spermatocytes of the testis. Also found in the kidney, liver and heart EMBL; AB076078; BAC20954.1; -; mRNA EMBL; AK043498; BAC31560.1; -; mRNA EMBL; AK043845; BAC31678.1; -; mRNA EMBL; AK041987; BAC31123.1; -; mRNA EMBL; AK083689; BAC38994.1; -; mRNA EMBL; AK154398; BAE32559.1; -; mRNA EMBL; AK155421; BAE33257.1; -; mRNA EMBL; BC066151; AAH66151.1; -; mRNA EMBL; BC138563; AAI38564.1; -; mRNA CCDS; CCDS19277.1; -. [Q3U285-3] CCDS; CCDS19278.1; -. [Q3U285-2] CCDS; CCDS51499.1; -. [Q3U285-1] RefSeq; NP_001156545.1; NM_001163073.1. [Q3U285-1] RefSeq; NP_742165.1; NM_172153.3. [Q3U285-2] RefSeq; NP_835278.2; NM_178142.5. [Q3U285-3] RefSeq; XP_006503888.1; XM_006503825.3 UniGene; Mm.71498; - ProteinModelPortal; Q3U285; - SMR; Q3U285; - STRING; 10090.ENSMUSP00000016026; - iPTMnet; Q3U285; - PhosphoSitePlus; Q3U285; - MaxQB; Q3U285; - PaxDb; Q3U285; - PeptideAtlas; Q3U285; - PRIDE; Q3U285; - Ensembl; ENSMUST00000016026; ENSMUSP00000016026; ENSMUSG00000015882. [Q3U285-1] Ensembl; ENSMUST00000045586; ENSMUSP00000042677; ENSMUSG00000015882. [Q3U285-3] Ensembl; ENSMUST00000087164; ENSMUSP00000084408; ENSMUSG00000015882. [Q3U285-2] GeneID; 209707; - KEGG; mmu:209707; - UCSC; uc008xjh.3; mouse. [Q3U285-3] UCSC; uc008xji.3; mouse. [Q3U285-6] UCSC; uc008xjk.2; mouse. [Q3U285-1] CTD; 254251; - MGI; MGI:2651932; Lcorl eggNOG; KOG4565; Eukaryota eggNOG; ENOG4111GCI; LUCA GeneTree; ENSGT00520000055615; - HOVERGEN; HBG108084; - InParanoid; Q3U285; - OMA; YKVKERS; - OrthoDB; EOG091G0N6A; - PhylomeDB; Q3U285; - TreeFam; TF319589; - ChiTaRS; Lcorl; mouse PRO; PR:Q3U285; - Proteomes; UP000000589; Chromosome 5 Bgee; ENSMUSG00000015882; - ExpressionAtlas; Q3U285; baseline and differential Genevisible; Q3U285; MM GO; GO:0005634; C:nucleus; IEA:UniProtKB-SubCell GO; GO:0003677; F:DNA binding; IEA:UniProtKB-KW GO; GO:0006357; P:regulation of transcription by RNA polymerase II; IDA:MGI GO; GO:0006366; P:transcription by RNA polymerase II; IDA:MGI InterPro; IPR009057; Homeobox-like_sf InterPro; IPR007889; HTH_Psq Pfam; PF05225; HTH_psq; 2 SUPFAM; SSF46689; SSF46689; 2 PROSITE; PS50960; HTH_PSQ; 1 2: Evidence at transcript level; Activator; Alternative splicing; Complete proteome; DNA-binding; Isopeptide bond; Nucleus; Reference proteome; Transcription; Transcription regulation; Ubl conjugation CHAIN 1 600 Ligand-dependent nuclear receptor corepressor-like protein /FTId=PRO_0000310464 DOMAIN 515 567 HTH psq-type. {ECO:0000255|PROSITE- ProRule:PRU00320} DNA_BIND 543 563 H-T-H motif. {ECO:0000255|PROSITE- ProRule:PRU00320} COMPBIAS 9 30 Ala-rich CROSSLNK 241 241 Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) {ECO:0000250|UniProtKB:Q8N3X6} CROSSLNK 318 318 Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) {ECO:0000250|UniProtKB:Q8N3X6} CROSSLNK 339 339 Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) {ECO:0000250|UniProtKB:Q8N3X6} CROSSLNK 396 396 Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) {ECO:0000250|UniProtKB:Q8N3X6} VAR_SEQ 1 83 Missing (in isoform 2) /FTId=VSP_029291 VAR_SEQ 143 164 DLPQNCDPNIPLVAQELMKKMI -> ADSSIWVFKRSPTNS WVSVVGY (in isoform 5) /FTId=VSP_029292 VAR_SEQ 165 600 Missing (in isoform 5) /FTId=VSP_029293 VAR_SEQ 227 230 GDGV -> ACYK (in isoform 4) /FTId=VSP_029294 VAR_SEQ 231 600 Missing (in isoform 4) /FTId=VSP_029295 VAR_SEQ 259 315 RLHRNREDYVERSAEFADGLLSKALKDIQSGALDINKAGIL YGIPQKTLLLHLEALP -> MLQMKTDEKVDLSDGNTASCP LSPIKMCLNHPIEWNLTAASLASCTVHNQNLKSEEN (in isoform 3). /FTId=VSP_029296 VAR_SEQ 316 600 Missing (in isoform 3) /FTId=VSP_029297 CONFLICT 18 21 Missing (in Ref. 3; AAH66151) SEQUENCE 600 AA; 66695 MW; F87DEC6D049B51B2 CRC64; MDKGRERMAA AAAAAAAAAA AQCRSPRCAA ERRGFRRELD SWRHRLMHCV GFESILEGLY GPRLRRDLSL FEDCEPEELT DWSMDEKCSF CNLQREAVSD CIPSLDSSQS TPTEELSSQG QSHTDKIECQ AESYLNALFR KKDLPQNCDP NIPLVAQELM KKMIRQFAIE YISKSGKIQE NRNGSIGASL VCKSIQMNQA DNCLQDEQEG PLDLTVTRTQ EQTAQQGDGV LDLSTKKTSI KSEESSISDP SSENAVAGRL HRNREDYVER SAEFADGLLS KALKDIQSGA LDINKAGILY GIPQKTLLLH LEALPAGKPA SFKNKTRDFN DSYSYNESKE TCAVLQKVAL WARAQTERTE KSKLNLLETS EFKFPTASSY LHQLTLQKMV TQFKEKNESL QYETSNPPVQ LKIPQLRVNS VSKSQADGSG LLDVMYQVSK TSSVLEGSAL QKLKNILPKQ NKLDCSGPVT HSSVDSYFLH GDLSPLCLNS KNGTVDGTSE NTEDGLDRKD NKQPRKKRGR YRQYDHEIME EAIAMVMSGK MSVSKAQGIY GVPHSTLEYK VKERSGTLKT PPKKKLRLPD TGLYMTDSGT GSCRNSSKPV
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to
info@abgent.com, and receive a free "I Love Antibodies" mug.
FeedBack
Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abgent.com.

$ 295.00
Cat# AI11679
Size:
Quantity:
Availability: 2-3 days
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions
"