Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Antibody Collections   >   Zebrafish   >   ADARB2 antibody - middle region   

ADARB2 antibody - middle region

Rabbit Polyclonal Antibody

     
  • WB - ADARB2 antibody - middle region AI11815

    WB Suggested Anti-ADARB2 Antibody Titration: 0.2-1 μg/ml
    ELISA Titer: 1:312500
    Positive Control: Human heart
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
WB
Primary Accession Q9NS39
Other Accession NM_018702, NP_061172
Reactivity Human, Mouse, Rat, Rabbit, Zebrafish, Pig, Horse, Bovine, Dog
Predicted Human, Mouse, Rat, Rabbit, Chicken, Bovine
Host Rabbit
Clonality Polyclonal
Calculated MW 80kDa
Additional Information
Alias Symbol ADAR3, FLJ25034, FLJ36975, RED2, hRED2
Other Names Double-stranded RNA-specific editase B2, 3.5.-.-, RNA-dependent adenosine deaminase 3, RNA-editing deaminase 2, RNA-editing enzyme 2, dsRNA adenosine deaminase B2, ADARB2, ADAR3, RED2
Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution & Storage Add 50 ul of distilled water. Final anti-ADARB2 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at 20°C. Avoid repeat freeze-thaw cycles.
PrecautionsADARB2 antibody - middle region is for research use only and not for use in diagnostic or therapeutic procedures.
Protein Information
Name ADARB2
Synonyms ADAR3, RED2
Function Lacks editing activity. It prevents the binding of other ADAR enzymes to targets in vitro, and decreases the efficiency of these enzymes. Capable of binding to dsRNA but also to ssRNA.
Cellular Location Nucleus.
Tissue Location Brain specific. Expressed at higher levels in astrocytomas as compared to the normal brain tissue EMBL; AF034837; AAF78094.1; -; mRNA EMBL; AK055107; BAG51468.1; -; mRNA EMBL; AL442069; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; AL450386; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; AC026224; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; AL392083; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; AL513304; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; BC137477; AAI37478.1; -; mRNA EMBL; BC140852; AAI40853.1; -; mRNA CCDS; CCDS7058.1; -. [Q9NS39-1] RefSeq; NP_061172.1; NM_018702.3. [Q9NS39-1] UniGene; Hs.586663; - ProteinModelPortal; Q9NS39; - SMR; Q9NS39; - BioGrid; 106619; 9 IntAct; Q9NS39; 5 STRING; 9606.ENSP00000370713; - iPTMnet; Q9NS39; - PhosphoSitePlus; Q9NS39; - BioMuta; ADARB2; - DMDM; 33112436; - SWISS-2DPAGE; Q9NS39; - EPD; Q9NS39; - PaxDb; Q9NS39; - PeptideAtlas; Q9NS39; - PRIDE; Q9NS39; - ProteomicsDB; 82477; - Ensembl; ENST00000381310; ENSP00000370711; ENSG00000185736. [Q9NS39-2] Ensembl; ENST00000381312; ENSP00000370713; ENSG00000185736. [Q9NS39-1] GeneID; 105; - KEGG; hsa:105; - UCSC; uc001igm.5; human. [Q9NS39-1] CTD; 105; - DisGeNET; 105; - EuPathDB; HostDB:ENSG00000185736.15; - GeneCards; ADARB2; - HGNC; HGNC:227; ADARB2 MIM; 602065; gene neXtProt; NX_Q9NS39; - OpenTargets; ENSG00000185736; - PharmGKB; PA24557; - eggNOG; KOG2777; Eukaryota eggNOG; ENOG410XT0Z; LUCA GeneTree; ENSGT00550000074412; - HOGENOM; HOG000290164; - HOVERGEN; HBG003836; - InParanoid; Q9NS39; - KO; K13194; - OMA; CKLQLIW; - OrthoDB; EOG091G0MZP; - PhylomeDB; Q9NS39; - TreeFam; TF315806; - ChiTaRS; ADARB2; human GeneWiki; ADARB2; - GenomeRNAi; 105; - PRO; PR:Q9NS39; - Proteomes; UP000005640; Chromosome 10 Bgee; ENSG00000185736; - CleanEx; HS_ADARB2; - ExpressionAtlas; Q9NS39; baseline and differential Genevisible; Q9NS39; HS GO; GO:0005634; C:nucleus; IEA:UniProtKB-SubCell GO; GO:0004000; F:adenosine deaminase activity; TAS:ProtInc GO; GO:0003725; F:double-stranded RNA binding; TAS:ProtInc GO; GO:0046872; F:metal ion binding; IEA:UniProtKB-KW GO; GO:0003723; F:RNA binding; HDA:UniProtKB GO; GO:0003727; F:single-stranded RNA binding; TAS:ProtInc GO; GO:0006397; P:mRNA processing; IEA:UniProtKB-KW InterPro; IPR002466; A_deamin InterPro; IPR014720; dsRBD_dom Pfam; PF02137; A_deamin; 1 Pfam; PF00035; dsrm; 2 SMART; SM00552; ADEAMc; 1 SMART; SM00358; DSRM; 2 PROSITE; PS50141; A_DEAMIN_EDITASE; 1 PROSITE; PS50137; DS_RBD; 2 1: Evidence at protein level; Alternative splicing; Complete proteome; Hydrolase; Metal-binding; mRNA processing; Nucleus; Polymorphism; Reference proteome; Repeat; RNA-binding; Zinc CHAIN 1 739 Double-stranded RNA-specific editase B2 /FTId=PRO_0000171782 DOMAIN 125 191 DRBM 1. {ECO:0000255|PROSITE- ProRule:PRU00266} DOMAIN 274 341 DRBM 2. {ECO:0000255|PROSITE- ProRule:PRU00266} DOMAIN 408 735 A to I editase. {ECO:0000255|PROSITE- ProRule:PRU00240} REGION 23 35 R-domain (ssRNA-binding) ACT_SITE 434 434 Proton donor. {ECO:0000255|PROSITE- ProRule:PRU00240} METAL 432 432 Zinc. {ECO:0000255|PROSITE- ProRule:PRU00240} METAL 490 490 Zinc. {ECO:0000255|PROSITE- ProRule:PRU00240} METAL 555 555 Zinc. {ECO:0000255|PROSITE- ProRule:PRU00240} VAR_SEQ 1 69 MASVLGSGRGSGGLSSQLKCKSKRRRRRRSKRKDKVSILST FLAPFKHLSPGITNTEDDDTLSTSSAEV -> MGLWSPVPG NSVPRAPVMAGLGLGHSQGAPQGPHDGKTDRSSGPGRRRTE RTRLPGLLGGAPLTAGSPH (in isoform 2) /FTId=VSP_056926 VAR_SEQ 70 560 Missing (in isoform 2) /FTId=VSP_056927 VARIANT 44 44 A -> T (in dbSNP:rs3793733) /FTId=VAR_020438 VARIANT 210 210 T -> M (in a colorectal cancer sample; somatic mutation) /FTId=VAR_035806 VARIANT 512 512 V -> I (in a colorectal cancer sample; somatic mutation; dbSNP:rs138734198) /FTId=VAR_035807 VARIANT 626 626 A -> T (in dbSNP:rs2271275) /FTId=VAR_048726 SEQUENCE 739 AA; 80621 MW; A158A81D35894F79 CRC64; MASVLGSGRG SGGLSSQLKC KSKRRRRRRS KRKDKVSILS TFLAPFKHLS PGITNTEDDD TLSTSSAEVK ENRNVGNLAA RPPPSGDRAR GGAPGAKRKR PLEEGNGGHL CKLQLVWKKL SWSVAPKNAL VQLHELRPGL QYRTVSQTGP VHAPVFAVAV EVNGLTFEGT GPTKKKAKMR AAELALRSFV QFPNACQAHL AMGGGPGPGT DFTSDQADFP DTLFQEFEPP APRPGLAGGR PGDAALLSAA YGRRRLLCRA LDLVGPTPAT PAAPGERNPV VLLNRLRAGL RYVCLAEPAE RRARSFVMAV SVDGRTFEGS GRSKKLARGQ AAQAALQELF DIQMPGHAPG RARRTPMPQE FADSISQLVT QKFREVTTDL TPMHARHKAL AGIVMTKGLD ARQAQVVALS SGTKCISGEH LSDQGLVVND CHAEVVARRA FLHFLYTQLE LHLSKRREDS ERSIFVRLKE GGYRLRENIL FHLYVSTSPC GDARLHSPYE ITTDLHSSKH LVRKFRGHLR TKIESGEGTV PVRGPSAVQT WDGVLLGEQL ITMSCTDKIA RWNVLGLQGA LLSHFVEPVY LQSIVVGSLH HTGHLARVMS HRMEGVGQLP ASYRHNRPLL SGVSDAEARQ PGKSPPFSMN WVVGSADLEI INATTGRRSC GGPSRLCKHV LSARWARLYG RLSTRTPSPG DTPSMYCEAK LGAHTYQSVK QQLFKAFQKA GLGTWVRKPP EQQQFLLTL
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to
info@abgent.com, and receive a free "I Love Antibodies" mug.

References

Andersen,J.S., (2005) Nature 433 (7021), 77-83 Reconstitution and Storage:For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

FeedBack
Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abgent.com.

$ 295.00
Cat# AI11815
Size:
Quantity:
Availability: 2-3 days
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions
"