Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Neuroscience   >   Rbfox1 Antibody - N-terminal region   

Rbfox1 Antibody - N-terminal region

Rabbit Polyclonal Antibody

     
  • WB - Rbfox1 Antibody - N-terminal region AI11816

    Host: Rabbit
    Target Name: Rbfox1
    Sample Tissue: Mouse Testis lysates
    Antibody Dilution: 1.0μg/ml
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
WB
Primary Accession Q9JJ43
Other Accession NM_021477, NP_067452
Reactivity Human, Mouse, Rat, Horse, Bovine, Dog
Predicted Human, Mouse, Rat, Pig, Dog
Host Rabbit
Clonality Polyclonal
Calculated MW 43kDa
Additional Information
Alias Symbol A2bp, Hrnbp1, fox-1
Other Names RNA binding protein fox-1 homolog 1, Ataxin-2-binding protein 1, Fox-1 homolog A, Rbfox1, A2bp, A2bp1, Fox1
Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution & Storage Add 50 ul of distilled water. Final anti-Rbfox1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at 20°C. Avoid repeat freeze-thaw cycles.
PrecautionsRbfox1 Antibody - N-terminal region is for research use only and not for use in diagnostic or therapeutic procedures.
Protein Information
Name Rbfox1
Synonyms A2bp, A2bp1, Fox1
Function RNA-binding protein that regulates alternative splicing events by binding to 5'-UGCAUGU-3' elements. Prevents binding of U2AF2 to the 3'-splice site. Regulates alternative splicing of tissue-specific exons and of differentially spliced exons during erythropoiesis.
Cellular Location Nucleus. Cytoplasm. Note=Predominantly nuclear
Tissue Location Detected in brain (at protein level). Detected in heart, brain, neurons, skeletal muscle and embryo EMBL; AF107204; AAF78292.1; -; mRNA EMBL; AY659954; AAV74337.1; -; mRNA EMBL; AY659955; AAV74338.1; -; mRNA EMBL; AY659956; AAV74339.1; -; mRNA EMBL; AY659957; AAV74340.1; -; mRNA EMBL; AY659958; AAV74341.1; -; mRNA EMBL; AF191501; AAL83425.1; -; mRNA EMBL; AB041596; BAA95079.1; -; mRNA EMBL; AK134833; BAE22304.1; -; mRNA EMBL; BC059002; AAH59002.1; -; mRNA CCDS; CCDS27936.1; -. [Q9JJ43-3] CCDS; CCDS37245.1; -. [Q9JJ43-1] RefSeq; NP_067452.2; NM_021477.5. [Q9JJ43-1] RefSeq; NP_899011.2; NM_183188.2. [Q9JJ43-3] RefSeq; XP_006522251.1; XM_006522188.1 RefSeq; XP_006522252.1; XM_006522189.3. [Q9JJ43-6] RefSeq; XP_006522253.1; XM_006522190.1. [Q9JJ43-4] RefSeq; XP_006522255.1; XM_006522192.3. [Q9JJ43-2] RefSeq; XP_011244213.1; XM_011245911.2. [Q9JJ43-1] RefSeq; XP_011244218.1; XM_011245916.1. [Q9JJ43-5] RefSeq; XP_017172487.1; XM_017316998.1 RefSeq; XP_017172491.1; XM_017317002.1. [Q9JJ43-5] UniGene; Mm.370334; - ProteinModelPortal; Q9JJ43; - BioGrid; 234568; 1 IntAct; Q9JJ43; 2 MINT; Q9JJ43; - STRING; 10090.ENSMUSP00000049970; - iPTMnet; Q9JJ43; - PhosphoSitePlus; Q9JJ43; - PaxDb; Q9JJ43; - PeptideAtlas; Q9JJ43; - PRIDE; Q9JJ43; - Ensembl; ENSMUST00000056416; ENSMUSP00000049970; ENSMUSG00000008658. [Q9JJ43-1] Ensembl; ENSMUST00000115841; ENSMUSP00000111507; ENSMUSG00000008658. [Q9JJ43-1] Ensembl; ENSMUST00000229741; ENSMUSP00000155364; ENSMUSG00000008658. [Q9JJ43-3] GeneID; 268859; - KEGG; mmu:268859; - UCSC; uc007ycb.2; mouse. [Q9JJ43-1] UCSC; uc007ycc.2; mouse. [Q9JJ43-4] UCSC; uc007ycf.2; mouse. [Q9JJ43-3] UCSC; uc007ycg.2; mouse. [Q9JJ43-6] UCSC; uc007ych.2; mouse. [Q9JJ43-7] UCSC; uc007yci.2; mouse. [Q9JJ43-5] CTD; 54715; - MGI; MGI:1926224; Rbfox1 eggNOG; KOG0125; Eukaryota eggNOG; ENOG4111WJT; LUCA GeneTree; ENSGT00390000013767; - HOVERGEN; HBG000044; - InParanoid; Q9JJ43; - KO; K14946; - OMA; LVYTSAX; - OrthoDB; EOG091G15X5; - PhylomeDB; Q9JJ43; - TreeFam; TF315942; - ChiTaRS; Rbfox1; mouse PRO; PR:Q9JJ43; - Proteomes; UP000000589; Chromosome 16 Bgee; ENSMUSG00000008658; - CleanEx; MM_A2BP1; - Genevisible; Q9JJ43; MM GO; GO:0005737; C:cytoplasm; IDA:MGI GO; GO:0005634; C:nucleus; IDA:MGI GO; GO:0005802; C:trans-Golgi network; ISO:MGI GO; GO:0003729; F:mRNA binding; IBA:GO_Central GO; GO:0008022; F:protein C-terminus binding; ISO:MGI GO; GO:0006397; P:mRNA processing; IEA:UniProtKB-KW GO; GO:0007399; P:nervous system development; IBA:GO_Central GO; GO:0050885; P:neuromuscular process controlling balance; IGI:MGI GO; GO:0000381; P:regulation of alternative mRNA splicing, via spliceosome; IMP:MGI GO; GO:2001014; P:regulation of skeletal muscle cell differentiation; IMP:MGI GO; GO:0008380; P:RNA splicing; IEA:UniProtKB-KW CDD; cd12407; RRM_FOX1_like; 1 Gene3D; 3.30.70.330; -; 1 InterPro; IPR025670; Fox-1_C_dom InterPro; IPR034237; FOX1_RRM InterPro; IPR012677; Nucleotide-bd_a/b_plait_sf InterPro; IPR035979; RBD_domain_sf InterPro; IPR017325; RNA-bd_Fox-1 InterPro; IPR000504; RRM_dom Pfam; PF12414; Fox-1_C; 1 Pfam; PF00076; RRM_1; 1 PIRSF; PIRSF037932; Ataxin_2_bd_A2BP; 1 SMART; SM00360; RRM; 1 SUPFAM; SSF54928; SSF54928; 1 PROSITE; PS50102; RRM; 1 1: Evidence at protein level; Alternative splicing; Complete proteome; Cytoplasm; Methylation; mRNA processing; mRNA splicing; Nucleus; Reference proteome; RNA-binding CHAIN 1 396 RNA binding protein fox-1 homolog 1 /FTId=PRO_0000081481 DOMAIN 116 192 RRM. {ECO:0000255|PROSITE- ProRule:PRU00176} SITE 117 117 Interaction with RNA. SITE 125 125 Interaction with RNA. SITE 126 126 Interaction with RNA. SITE 150 150 Interaction with RNA. SITE 155 155 Interaction with RNA. SITE 159 159 Interaction with RNA. SITE 183 183 Interaction with RNA. SITE 193 193 Interaction with RNA. MOD_RES 316 316 Asymmetric dimethylarginine MOD_RES 387 387 Omega-N-methylarginine VAR_SEQ 1 20 Missing (in isoform 2) /FTId=VSP_030879 VAR_SEQ 1 9 MNCEREQLR -> MLASQGVLLHSYGVPMIVPAAPYFPGLM Q (in isoform 3, isoform 6 and isoform 7). {ECO:0000303|PubMed:15824060, ECO:0000303|PubMed:16141072, ECO:0000303|Ref.3} /FTId=VSP_030880 VAR_SEQ 156 186 Missing (in isoform 7) /FTId=VSP_030881 VAR_SEQ 207 224 Missing (in isoform 4) /FTId=VSP_030882 VAR_SEQ 301 309 DGFYGADIY -> EPVYGNKLLQ (in isoform 3, isoform 6 and isoform 7) {ECO:0000303|PubMed:15824060, ECO:0000303|PubMed:16141072, ECO:0000303|Ref.3} /FTId=VSP_030883 VAR_SEQ 331 396 SYGRVYAADPYHHTLAPAPTYGVGAMNAFAPLTDAKTRSHA DDVGLVLSSLQASIYRGGYNRFAPY -> RNQFVFVATDEI SCNTSAVTDEFMLPTPTTTHLLQPPPTALVP (in isoform 5, isoform 6 and isoform 7) /FTId=VSP_030884 CONFLICT 60 60 D -> G (in Ref. 4; BAA95079) CONFLICT 124 124 P -> PFR (in Ref. 1; AAF78292) CONFLICT 136 136 F -> FS (in Ref. 1; AAF78292) CONFLICT 261 261 T -> S (in Ref. 3; AAL83425) CONFLICT 278 278 V -> G (in Ref. 3; AAL83425) CONFLICT 282 282 F -> L (in Ref. 3; AAL83425) CONFLICT 369 369 S -> G (in Ref. 4; BAA95079) SEQUENCE 396 AA; 42678 MW; E64DBA6FE6A062ED CRC64; MNCEREQLRG NQEAAAAPDT MAQPYASAQF APPQNGIPAE YTAPHPHPAP EYTGQTTVPD HTLNLYPPTQ THSEQSADTS AQTVSGTATQ TDDAAPTDGQ PQTQPSENTE SKSQPKRLHV SNIPFRFRDP DLRQMFGQFG KILDVEIIFN ERGSKGFGFV TFENSADADR AREKLHGTVV EGRKIEVNNA TARVMTNKKT VNPYTNGWKL NPVVGAVYSP DFYAGTVLLC QANQEGSSMY SGPSSLVYTS AMPGFPYPAA TAAAAYRGAH LRGRGRTVYN TFRAAAPPPP IPAYGGVVYQ DGFYGADIYG GYAAYRYAQP TPATAAAYSD SYGRVYAADP YHHTLAPAPT YGVGAMNAFA PLTDAKTRSH ADDVGLVLSS LQASIYRGGY NRFAPY
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to
info@abgent.com, and receive a free "I Love Antibodies" mug.
FeedBack
Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abgent.com.

$ 295.00
Cat# AI11816
Size:
Quantity:
Availability: 2-3 days
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions
"