Register or Login
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Neuroscience   >   GBX2 Antibody (Internal)   

GBX2 Antibody (Internal)

Goat Polyclonal Antibody

  • IHC - GBX2 Antibody (Internal) ALS13089
    Anti-GBX2 antibody IHC of human brain, cortex.
  • IHC - GBX2 Antibody (Internal) ALS13089
    Anti-GBX2 antibody IHC of human placenta.
Product Information
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
Primary Accession P52951
Reactivity Human, Mouse, Rat, Hamster, Monkey, Pig, Horse, Bovine, Dog
Host Goat
Clonality Polyclonal
Calculated MW 37kDa
Dilution ELISA (1:16000), IHC-P (3.75 µg/ml), WB (0.1-0.3 µg/ml)
Additional Information
Other Names Homeobox protein GBX-2, Gastrulation and brain-specific homeobox protein 2, GBX2
Target/Specificity Human GBX2.
Reconstitution & Storage Store at -20°C. Minimize freezing and thawing.
PrecautionsGBX2 Antibody (Internal) is for research use only and not for use in diagnostic or therapeutic procedures.
Protein Information
Name GBX2
Function May act as a transcription factor for cell pluripotency and differentiation in the embryo.
Cellular Location Nucleus. EMBL; U31468; AAC03241.1; -; Genomic_DNA EMBL; AF118452; AAD39907.1; -; mRNA EMBL; AC079135; AAX93240.1; -; Genomic_DNA EMBL; CH471063; EAW71084.1; -; Genomic_DNA EMBL; BC137448; AAI37449.1; -; mRNA EMBL; BC137449; AAI37450.1; -; mRNA EMBL; U02080; AAA17406.1; -; Genomic_DNA CCDS; CCDS2515.1; - PIR; S39540; S39540 RefSeq; NP_001476.2; NM_001485.3 UniGene; Hs.184945; - UniGene; Hs.735751; - ProteinModelPortal; P52951; - SMR; P52951; - BioGrid; 108907; 3 STRING; 9606.ENSP00000302251; - iPTMnet; P52951; - PhosphoSitePlus; P52951; - BioMuta; GBX2; - DMDM; 12644308; - EPD; P52951; - MaxQB; P52951; - PaxDb; P52951; - PeptideAtlas; P52951; - PRIDE; P52951; - ProteomicsDB; 56561; - Ensembl; ENST00000306318; ENSP00000302251; ENSG00000168505 GeneID; 2637; - KEGG; hsa:2637; - UCSC; uc002vvw.2; human CTD; 2637; - DisGeNET; 2637; - EuPathDB; HostDB:ENSG00000168505.6; - GeneCards; GBX2; - HGNC; HGNC:4186; GBX2 HPA; HPA067809; - MIM; 601135; gene neXtProt; NX_P52951; - OpenTargets; ENSG00000168505; - PharmGKB; PA28600; - eggNOG; KOG0489; Eukaryota eggNOG; ENOG410ZTBY; LUCA GeneTree; ENSGT00910000144024; - HOGENOM; HOG000060099; - HOVERGEN; HBG003967; - InParanoid; P52951; - KO; K09321; - OMA; FMPYRSV; - OrthoDB; EOG091G0SCQ; - PhylomeDB; P52951; - TreeFam; TF351530; - GeneWiki; GBX2; - GenomeRNAi; 2637; - PRO; PR:P52951; - Proteomes; UP000005640; Chromosome 2 Bgee; ENSG00000168505; - CleanEx; HS_GBX2; - ExpressionAtlas; P52951; baseline and differential Genevisible; P52951; HS GO; GO:0005634; C:nucleus; IEA:UniProtKB-SubCell GO; GO:0003700; F:DNA binding transcription factor activity; TAS:ProtInc GO; GO:0000979; F:RNA polymerase II core promoter sequence-specific DNA binding; IEA:Ensembl GO; GO:0000981; F:RNA polymerase II transcription factor activity, sequence-specific DNA binding; ISA:NTNU_SB GO; GO:0001190; F:transcriptional activator activity, RNA polymerase II transcription factor binding; IEA:Ensembl GO; GO:0001228; F:transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific DNA binding; IEA:Ensembl GO; GO:0048483; P:autonomic nervous system development; IEA:Ensembl GO; GO:0007411; P:axon guidance; IEA:Ensembl GO; GO:0001569; P:branching involved in blood vessel morphogenesis; IEA:Ensembl GO; GO:0021930; P:cerebellar granule cell precursor proliferation; IEA:Ensembl GO; GO:0021549; P:cerebellum development; IEA:Ensembl GO; GO:0021884; P:forebrain neuron development; IEA:Ensembl GO; GO:0042472; P:inner ear morphogenesis; IEA:Ensembl GO; GO:0021555; P:midbrain-hindbrain boundary morphogenesis; IEA:Ensembl GO; GO:0007399; P:nervous system development; TAS:ProtInc GO; GO:0001755; P:neural crest cell migration; IEA:Ensembl GO; GO:0021568; P:rhombomere 2 development; IEA:Ensembl GO; GO:0021794; P:thalamus development; IEA:Ensembl CDD; cd00086; homeodomain; 1 InterPro; IPR031250; GBX-2 InterPro; IPR009057; Homeobox-like_sf InterPro; IPR017970; Homeobox_CS InterPro; IPR001356; Homeobox_dom InterPro; IPR020479; Homeobox_metazoa PANTHER; PTHR24334:SF3; PTHR24334:SF3; 1 Pfam; PF00046; Homeobox; 1 PRINTS; PR00024; HOMEOBOX SMART; SM00389; HOX; 1 SUPFAM; SSF46689; SSF46689; 1 PROSITE; PS00027; HOMEOBOX_1; 1 PROSITE; PS50071; HOMEOBOX_2; 1 2: Evidence at transcript level; Complete proteome; DNA-binding; Homeobox; Nucleus; Reference proteome; Transcription; Transcription regulation CHAIN 1 348 Homeobox protein GBX-2 /FTId=PRO_0000048880 DNA_BIND 247 306 Homeobox. {ECO:0000255|PROSITE- ProRule:PRU00108} COMPBIAS 56 63 Poly-Pro COMPBIAS 121 124 Poly-Ala COMPBIAS 248 251 Poly-Arg CONFLICT 74 194 LPPAHPHHQIPSLPTGFCSSLAQGMALTSTLMATLPGGFSA SPQHQEAAAARKFAPQPLPGGGNFDKAEALQADAEDGKGFL AKEGSLLAFSAAETVQASLVGAVRGQGKDESKVEDDPKG -> CRPHTLTTRSPACPQASAPAWRRAWRSPLRSWPRSPAA SPRRPSTRRRQRPASSRRSRCPAAVTSTRRRRCRLTRRTAK ASWPKRARCSPSPRPRRCRLRSSGLSEGKGKTSQRWKTTRS (in Ref. 1; AAC03241). CONFLICT 216 237 QAAHKEEDPGHALEETPPSSGA -> PGSSQGGRPGPRGGG DPAEQRR (in Ref. 6). SEQUENCE 348 AA; 37348 MW; 5D31EA57B0CB07C0 CRC64; MSAAFPPSLM MMQRPLGSST AFSIDSLIGS PPQPSPGHFV YTGYPMFMPY RPVVLPPPPP PPPALPQAAL QPALPPAHPH HQIPSLPTGF CSSLAQGMAL TSTLMATLPG GFSASPQHQE AAAARKFAPQ PLPGGGNFDK AEALQADAED GKGFLAKEGS LLAFSAAETV QASLVGAVRG QGKDESKVED DPKGKEESFS LESDVDYSSD DNLTGQAAHK EEDPGHALEE TPPSSGAAGS TTSTGKNRRR RTAFTSEQLL ELEKEFHCKK YLSLTERSQI AHALKLSEVQ VKIWFQNRRA KWKRVKAGNA NSKTGEPSRN PKIVVPIPVH VSRFAIRSQH QQLEQARP
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to, and receive a free "I Love Antibodies" mug.


May act as a transcription factor for cell pluripotency and differentiation in the embryo.


Lin X.,et al.Genomics 31:335-342(1996).
Gao A.C.,et al.Submitted (JAN-1999) to the EMBL/GenBank/DDBJ databases.
Hillier L.W.,et al.Nature 434:724-731(2005).
Mural R.J.,et al.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
Matsui T.,et al.FEBS Lett. 336:107-110(1993).

Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at

$ 425.00
Cat# ALS13089
Availability: 5 days
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions