Register or Login
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Signal Transduction   >   HMMR Antibody (C-term)   

HMMR Antibody (C-term)

Peptide Affinity Purified Rabbit Polyclonal Antibody (Pab)

Products labeled with a "crown" meet aggressive quality standards. Learn more.
  • WB - HMMR Antibody (C-term) AP11771b
    All lanes : Anti-HMMR Antibody (C-term) at 1:2000 dilution Lane 1: K562 whole cell lysates Lane 2: LNCaP whole cell lysates Lane 3: HL-60 whole cell lysates Lysates/proteins at 20 µg per lane. Secondary Goat Anti-Rabbit IgG, (H+L), Peroxidase conjugated at 1/10000 dilution Predicted band size : 84 kDa Blocking/Dilution buffer: 5% NFDM/TBST.
  • WB - HMMR Antibody (C-term) AP11771b
    HMMR Antibody (C-term) (Cat. #AP11771b) western blot analysis in Ramos cell line lysates (35ug/lane).This demonstrates the HMMR antibody detected the HMMR protein (arrow).
  • IHC-P - HMMR Antibody (C-term) AP11771b
    HMMR Antibody (C-term) (Cat. #AP11771b)immunohistochemistry analysis in formalin fixed and paraffin embedded human breast carcinoma followed by peroxidase conjugation of the secondary antibody and DAB staining.This data demonstrates the use of HMMR Antibody (C-term) for immunohistochemistry. Clinical relevance has not been evaluated.
  • FC - HMMR Antibody (C-term) AP11771b
    HMMR Antibody (C-term) (Cat. #AP11771b) flow cytometric analysis of Ramos cells (right histogram) compared to a negative control cell (left histogram).FITC-conjugated goat-anti-rabbit secondary antibodies were used for the analysis.
Product Information
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
Primary Accession O75330
Other Accession NP_036616.2
Reactivity Human
Host Rabbit
Clonality Polyclonal
Isotype Rabbit Ig
Antigen Region 668-697 aa
Additional Information
Other Names Hyaluronan mediated motility receptor, Intracellular hyaluronic acid-binding protein, Receptor for hyaluronan-mediated motility, CD168, HMMR, IHABP, RHAMM
Target/Specificity This HMMR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 668-697 amino acids from the C-terminal region of human HMMR.
Dilution WB~~1:1000
Format Purified polyclonal antibody supplied in PBS with 0.09% (W/V) sodium azide. This antibody is purified through a protein A column, followed by peptide affinity purification.
StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
PrecautionsHMMR Antibody (C-term) is for research use only and not for use in diagnostic or therapeutic procedures.
Protein Information
Function Receptor for hyaluronic acid (HA) (By similarity). Involved in cell motility (By similarity). When hyaluronan binds to HMMR, the phosphorylation of a number of proteins, including PTK2/FAK1 occurs. May also be involved in cellular transformation and metastasis formation, and in regulating extracellular- regulated kinase (ERK) activity. May act as a regulator of adipogenisis (By similarity).
Cellular Location Cell surface {ECO:0000250|UniProtKB:Q00547}. Cytoplasm {ECO:0000250|UniProtKB:Q00547}
Tissue Location Expressed in breast cancer cell lines and in normal breast tissue EMBL; U29343; AAC52049.1; -; mRNA EMBL; AF032862; AAC32548.1; -; mRNA EMBL; AK290577; BAF83266.1; -; mRNA EMBL; AK303616; BAG64626.1; -; mRNA EMBL; AC112205; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; CH471062; EAW61522.1; -; Genomic_DNA EMBL; CH471062; EAW61523.1; -; Genomic_DNA EMBL; CH471062; EAW61524.1; -; Genomic_DNA EMBL; CH471062; EAW61525.1; -; Genomic_DNA EMBL; BC108904; AAI08905.1; -; mRNA CCDS; CCDS4362.1; -. [O75330-1] CCDS; CCDS4363.1; -. [O75330-2] CCDS; CCDS47334.1; -. [O75330-3] CCDS; CCDS47335.1; -. [O75330-4] PIR; JC5016; JC5016 RefSeq; NP_001136028.1; NM_001142556.1. [O75330-3] RefSeq; NP_001136029.1; NM_001142557.1. [O75330-4] RefSeq; NP_036616.2; NM_012484.2. [O75330-1] RefSeq; NP_036617.2; NM_012485.2. [O75330-2] UniGene; Hs.740467; - ProteinModelPortal; O75330; - SMR; O75330; - BioGrid; 109404; 52 CORUM; O75330; - DIP; DIP-56496N; - IntAct; O75330; 31 MINT; O75330; - STRING; 9606.ENSP00000377492; - DrugBank; DB08818; Hyaluronic acid MoonDB; O75330; Curated iPTMnet; O75330; - PhosphoSitePlus; O75330; - BioMuta; HMMR; - REPRODUCTION-2DPAGE; O75330; - EPD; O75330; - MaxQB; O75330; - PaxDb; O75330; - PeptideAtlas; O75330; - PRIDE; O75330; - ProteomicsDB; 49897; - ProteomicsDB; 49898; -. [O75330-2] ProteomicsDB; 49899; -. [O75330-3] ProteomicsDB; 49900; -. [O75330-4] Ensembl; ENST00000353866; ENSP00000185942; ENSG00000072571. [O75330-2] Ensembl; ENST00000358715; ENSP00000351554; ENSG00000072571. [O75330-1] Ensembl; ENST00000393915; ENSP00000377492; ENSG00000072571. [O75330-3] Ensembl; ENST00000432118; ENSP00000402673; ENSG00000072571. [O75330-4] GeneID; 3161; - KEGG; hsa:3161; - UCSC; uc003lzf.5; human. [O75330-1] CTD; 3161; - DisGeNET; 3161; - EuPathDB; HostDB:ENSG00000072571.19; - GeneCards; HMMR; - H-InvDB; HIX0032412; - HGNC; HGNC:5012; HMMR HPA; CAB002433; - HPA; HPA040025; - HPA; HPA043926; - HPA; HPA061524; - MalaCards; HMMR; - MIM; 600936; gene neXtProt; NX_O75330; - OpenTargets; ENSG00000072571; - PharmGKB; PA29340; - eggNOG; ENOG410IJ28; Eukaryota eggNOG; ENOG4111G1K; LUCA GeneTree; ENSGT00390000007135; - HOVERGEN; HBG044411; - InParanoid; O75330; - KO; K06267; - OMA; ISCASDQ; - OrthoDB; EOG091G03MO; - PhylomeDB; O75330; - TreeFam; TF333963; - Reactome; R-HSA-2160916; Hyaluronan uptake and degradation Reactome; R-HSA-8854518; AURKA Activation by TPX2 GeneWiki; Hyaluronan-mediated_motility_receptor; - GenomeRNAi; 3161; - PRO; PR:O75330; - Proteomes; UP000005640; Chromosome 5 Bgee; ENSG00000072571; - CleanEx; HS_HMMR; - ExpressionAtlas; O75330; baseline and differential Genevisible; O75330; HS GO; GO:0009986; C:cell surface; IEA:UniProtKB-SubCell GO; GO:0005813; C:centrosome; IDA:HPA GO; GO:0005829; C:cytosol; IDA:HPA GO; GO:0016020; C:membrane; HDA:UniProtKB GO; GO:0015630; C:microtubule cytoskeleton; IDA:HPA GO; GO:0005886; C:plasma membrane; TAS:Reactome GO; GO:0005540; F:hyaluronic acid binding; IBA:GO_Central GO; GO:0030214; P:hyaluronan catabolic process; TAS:Reactome GO; GO:0010389; P:regulation of G2/M transition of mitotic cell cycle; TAS:Reactome InterPro; IPR031794; HMMR_C InterPro; IPR031787; HMMR_N InterPro; IPR026203; IHABP PANTHER; PTHR18956; PTHR18956; 2 Pfam; PF15908; HMMR_C; 1 Pfam; PF15905; HMMR_N; 1 1: Evidence at protein level; Alternative splicing; Complete proteome; Cytoplasm; Glycoprotein; Hyaluronic acid; Phosphoprotein; Polymorphism; Reference proteome; Repeat CHAIN 1 724 Hyaluronan mediated motility receptor /FTId=PRO_0000084007 REGION 635 645 Hyaluronic acid-binding. REGION 657 666 Hyaluronic acid-binding. MOD_RES 20 20 Phosphoserine MOD_RES 703 703 Phosphothreonine CARBOHYD 133 133 N-linked (GlcNAc...) asparagine CARBOHYD 477 477 N-linked (GlcNAc...) asparagine CARBOHYD 567 567 N-linked (GlcNAc...) asparagine CARBOHYD 588 588 N-linked (GlcNAc...) asparagine VAR_SEQ 1 90 MSFPKAPLKRFNDPSGCAPSPGAYDVKTLEVLKGPVSFQKS QRFKQQKESKQNLNVDKDTTLPASARKVKSSESKESQKNDK DLKILEKE -> MTLL (in isoform 4) /FTId=VSP_041266 VAR_SEQ 75 75 K -> KK (in isoform 3) /FTId=VSP_038378 VAR_SEQ 76 90 Missing (in isoform 2) /FTId=VSP_004286 VARIANT 92 92 R -> C (in dbSNP:rs299284) /FTId=VAR_024155 VARIANT 305 305 N -> K (in dbSNP:rs2303077) /FTId=VAR_031661 VARIANT 320 320 N -> K (in dbSNP:rs2303077) /FTId=VAR_056917 VARIANT 332 332 R -> H (in dbSNP:rs2303078) /FTId=VAR_024156 VARIANT 368 368 V -> A (in dbSNP:rs299290) /FTId=VAR_020044 VARIANT 484 484 A -> V (in dbSNP:rs299295) /FTId=VAR_024157 VARIANT 557 557 D -> H (in dbSNP:rs2230362) /FTId=VAR_056918 VARIANT 595 595 L -> I (in dbSNP:rs2230363) /FTId=VAR_056919 CONFLICT 103 103 R -> S (in Ref. 2; AAC32548) CONFLICT 277 277 E -> D (in Ref. 1; AAC52049) CONFLICT 298 298 K -> T (in Ref. 1; AAC52049) CONFLICT 322 322 K -> E (in Ref. 1; AAC52049) CONFLICT 330 332 QER -> REH (in Ref. 1; AAC52049) CONFLICT 547 547 Q -> R (in Ref. 3; BAF83266) SEQUENCE 724 AA; 84100 MW; F2C3C0DBA863955F CRC64; MSFPKAPLKR FNDPSGCAPS PGAYDVKTLE VLKGPVSFQK SQRFKQQKES KQNLNVDKDT TLPASARKVK SSESKESQKN DKDLKILEKE IRVLLQERGA QDRRIQDLET ELEKMEARLN AALREKTSLS ANNATLEKQL IELTRTNELL KSKFSENGNQ KNLRILSLEL MKLRNKRETK MRGMMAKQEG MEMKLQVTQR SLEESQGKIA QLEGKLVSIE KEKIDEKSET EKLLEYIEEI SCASDQVEKY KLDIAQLEEN LKEKNDEILS LKQSLEENIV ILSKQVEDLN VKCQLLEKEK EDHVNRNREH NENLNAEMQN LKQKFILEQQ EREKLQQKEL QIDSLLQQEK ELSSSLHQKL CSFQEEMVKE KNLFEEELKQ TLDELDKLQQ KEEQAERLVK QLEEEAKSRA EELKLLEEKL KGKEAELEKS SAAHTQATLL LQEKYDSMVQ SLEDVTAQFE SYKALTASEI EDLKLENSSL QEKAAKAGKN AEDVQHQILA TESSNQEYVR MLLDLQTKSA LKETEIKEIT VSFLQKITDL QNQLKQQEED FRKQLEDEEG RKAEKENTTA ELTEEINKWR LLYEELYNKT KPFQLQLDAF EVEKQALLNE HGAAQEQLNK IRDSYAKLLG HQNLKQKIKH VVKLKDENSQ LKSEVSKLRC QLAKKKQSET KLQEELNKVL GIKHFDPSKA FHHESKENFA LKTPLKEGNT NCYRAPMECQ ESWK
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to, and receive a free "I Love Antibodies" mug.


The protein encoded by this gene is involved in cell motility. It is expressed in breast tissue and together with other proteins, it forms a complex with BRCA1 and BRCA2, thus is potentially associated with higher risk of breast cancer. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.


Huang, T.W., et al. Biomaterials 31(26):6701-6709(2010)
Nagel, S., et al. Exp. Hematol. 38(1):38-45(2010)
Gust, K.M., et al. Neoplasia 11(9):956-963(2009)
Shigeishi, H., et al. Int. J. Oncol. 34(6):1565-1571(2009)
Luczynski, W., et al. Neoplasma 56(5):428-434(2009)

Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at

$ 325.00
$ 109.00
Cat# AP11771b
Availability: In Stock
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions