Register or Login
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Signal Transduction   >   HSPBP1 Antibody (N-term)   

HSPBP1 Antibody (N-term)

Peptide Affinity Purified Rabbit Polyclonal Antibody (Pab)

  • WB - HSPBP1 Antibody (N-term) AP14772A
    HSPBP1 Antibody (N-term) (Cat. #AP14772a) western blot analysis in Jurkat cell line lysates (35ug/lane).This demonstrates the HSPBP1 antibody detected the HSPBP1 protein (arrow).
  • IHC-P - HSPBP1 Antibody (N-term) AP14772A
    HSPBP1 Antibody (N-term) (AP14772a)immunohistochemistry analysis in formalin fixed and paraffin embedded human heart tissue followed by peroxidase conjugation of the secondary antibody and DAB staining.This data demonstrates the use of HSPBP1 Antibody (N-term) for immunohistochemistry. Clinical relevance has not been evaluated.
Product Information
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
Primary Accession Q9NZL4
Other Accession Q6IMX7, Q99P31, Q4R588, NP_036399.3, NP_001123578.1
Reactivity Human
Predicted Monkey, Mouse
Host Rabbit
Clonality Polyclonal
Isotype Rabbit Ig
Antigen Region 69-97 aa
Additional Information
Other Names Hsp70-binding protein 1, HspBP1, Heat shock protein-binding protein 1, Hsp70-binding protein 2, HspBP2, Hsp70-interacting protein 1, Hsp70-interacting protein 2, HSPBP1, HSPBP
Target/Specificity This HSPBP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 69-97 amino acids from the N-terminal region of human HSPBP1.
Dilution WB~~1:1000
Format Purified polyclonal antibody supplied in PBS with 0.09% (W/V) sodium azide. This antibody is purified through a protein A column, followed by peptide affinity purification.
StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
PrecautionsHSPBP1 Antibody (N-term) is for research use only and not for use in diagnostic or therapeutic procedures.
Protein Information
Synonyms HSPBP
Function Inhibits HSPA1A chaperone activity by changing the conformation of the ATP-binding domain of HSPA1A and interfering with ATP binding. Interferes with ubiquitination mediated by STUB1 and inhibits chaperone-assisted degradation of immature CFTR.
Tissue Location Ubiquitous.. EMBL; AF093420; AAC79703.1; -; mRNA EMBL; AF187859; AAF35833.1; -; mRNA EMBL; AB020592; BAB18742.1; -; mRNA EMBL; AF217996; AAG17238.1; -; mRNA EMBL; AK130636; BAC85399.1; -; mRNA EMBL; AK294358; BAG57622.1; -; mRNA EMBL; CR457118; CAG33399.1; -; mRNA EMBL; AK075293; BAG52102.1; -; mRNA EMBL; BC001236; AAH01236.1; -; mRNA EMBL; BC002373; AAH02373.1; -; mRNA RefSeq; NP_001123578.1; NM_001130106.1 RefSeq; NP_001284529.1; NM_001297600.1. [Q9NZL4-3] RefSeq; NP_036399.3; NM_012267.4 RefSeq; XP_016882033.1; XM_017026544.1 UniGene; Hs.53066; - PDB; 1XQR; X-ray; 2.10 A; A/B=87-362 PDB; 1XQS; X-ray; 2.90 A; A/B=87-362 PDBsum; 1XQR; - PDBsum; 1XQS; - ProteinModelPortal; Q9NZL4; - SMR; Q9NZL4; - BioGrid; 117168; 93 IntAct; Q9NZL4; 29 MINT; Q9NZL4; - STRING; 9606.ENSP00000255631; - iPTMnet; Q9NZL4; - PhosphoSitePlus; Q9NZL4; - BioMuta; HSPBP1; - DMDM; 74734730; - EPD; Q9NZL4; - MaxQB; Q9NZL4; - PaxDb; Q9NZL4; - PeptideAtlas; Q9NZL4; - PRIDE; Q9NZL4; - ProteomicsDB; 83428; - ProteomicsDB; 83429; -. [Q9NZL4-2] DNASU; 23640; - Ensembl; ENST00000255631; ENSP00000255631; ENSG00000133265 Ensembl; ENST00000433386; ENSP00000398244; ENSG00000133265 Ensembl; ENST00000587922; ENSP00000467574; ENSG00000133265 GeneID; 23640; - KEGG; hsa:23640; - UCSC; uc002qkc.4; human. [Q9NZL4-1] CTD; 23640; - DisGeNET; 23640; - EuPathDB; HostDB:ENSG00000133265.10; - GeneCards; HSPBP1; - H-InvDB; HIX0015460; - HGNC; HGNC:24989; HSPBP1 HPA; CAB005865; - HPA; HPA071444; - MIM; 612939; gene neXtProt; NX_Q9NZL4; - PharmGKB; PA164720725; - eggNOG; KOG2160; Eukaryota eggNOG; ENOG410Y90B; LUCA HOGENOM; HOG000007740; - HOVERGEN; HBG053282; - InParanoid; Q9NZL4; - KO; K09562; - OrthoDB; EOG091G0HDF; - PhylomeDB; Q9NZL4; - TreeFam; TF324307; - ChiTaRS; HSPBP1; human EvolutionaryTrace; Q9NZL4; - GeneWiki; HSPBP1; - GenomeRNAi; 23640; - PRO; PR:Q9NZL4; - Proteomes; UP000005640; Chromosome 19 Bgee; ENSG00000133265; - ExpressionAtlas; Q9NZL4; baseline and differential Genevisible; Q9NZL4; HS GO; GO:0004857; F:enzyme inhibitor activity; TAS:ProtInc GO; GO:0031625; F:ubiquitin protein ligase binding; IPI:ARUK-UCL GO; GO:0032436; P:positive regulation of proteasomal ubiquitin-dependent protein catabolic process; IDA:BHF-UCL GO; GO:0031398; P:positive regulation of protein ubiquitination; IDA:BHF-UCL GO; GO:0006457; P:protein folding; TAS:ProtInc Gene3D;; -; 1 InterPro; IPR011989; ARM-like InterPro; IPR016024; ARM-type_fold InterPro; IPR013918; Nucleotide_exch_fac_Fes1 Pfam; PF08609; Fes1; 1 SUPFAM; SSF48371; SSF48371; 1 1: Evidence at protein level; 3D-structure; Alternative splicing; Complete proteome; Phosphoprotein; Polymorphism; Reference proteome; Repeat CHAIN 1 362 Hsp70-binding protein 1 /FTId=PRO_0000084035 REPEAT 135 177 ARM 1 REPEAT 180 220 ARM 2 REPEAT 223 262 ARM 3 REPEAT 265 304 ARM 4 COMPBIAS 21 40 Gly-rich MOD_RES 354 354 Phosphoserine MOD_RES 359 359 Phosphoserine VAR_SEQ 1 1 M -> MGGRRAPLKRRLLSRPSRIDPSGRQSCFSGDHLLPL THSSLLHKRPM (in isoform 3) /FTId=VSP_053681 VAR_SEQ 25 27 Missing (in isoform 3) /FTId=VSP_053682 VAR_SEQ 207 309 Missing (in isoform 2) /FTId=VSP_015945 VARIANT 25 27 Missing. {ECO:0000269|PubMed:15489334, ECO:0000269|PubMed:9830037, ECO:0000269|Ref.3, ECO:0000269|Ref.6} /FTId=VAR_023645 CONFLICT 276 276 M -> V (in Ref. 5; BAG57622) HELIX 90 104 {ECO:0000244|PDB:1XQR} HELIX 113 134 {ECO:0000244|PDB:1XQR} HELIX 137 145 {ECO:0000244|PDB:1XQR} HELIX 148 154 {ECO:0000244|PDB:1XQR} TURN 155 158 {ECO:0000244|PDB:1XQR} HELIX 162 176 {ECO:0000244|PDB:1XQR} HELIX 180 188 {ECO:0000244|PDB:1XQR} HELIX 191 201 {ECO:0000244|PDB:1XQR} HELIX 205 219 {ECO:0000244|PDB:1XQR} HELIX 223 231 {ECO:0000244|PDB:1XQR} HELIX 234 243 {ECO:0000244|PDB:1XQR} HELIX 247 263 {ECO:0000244|PDB:1XQR} HELIX 265 267 {ECO:0000244|PDB:1XQR} HELIX 268 273 {ECO:0000244|PDB:1XQR} HELIX 276 284 {ECO:0000244|PDB:1XQR} HELIX 291 303 {ECO:0000244|PDB:1XQR} HELIX 307 314 {ECO:0000244|PDB:1XQR} HELIX 316 318 {ECO:0000244|PDB:1XQR} HELIX 320 331 {ECO:0000244|PDB:1XQR} HELIX 335 337 {ECO:0000244|PDB:1XQR} HELIX 338 351 {ECO:0000244|PDB:1XQR} SEQUENCE 362 AA; 39474 MW; 2B6AAB4161D5A326 CRC64; MSDEGSRGSR LPLALPPASQ GCSSGGGGGG GGGSSAGGSG NSRPPRNLQG LLQMAITAGS EEPDPPPEPM SEERRQWLQE AMSAAFRGQR EEVEQMKSCL RVLSQPMPPT AGEAEQAADQ QEREGALELL ADLCENMDNA ADFCQLSGMH LLVGRYLEAG AAGLRWRAAQ LIGTCSQNVA AIQEQVLGLG ALRKLLRLLD RDACDTVRVK ALFAISCLVR EQEAGLLQFL RLDGFSVLMR AMQQQVQKLK VKSAFLLQNL LVGHPEHKGT LCSMGMVQQL VALVRTEHSP FHEHVLGALC SLVTDFPQGV RECREPELGL EELLRHRCQL LQQHEEYQEE LEFCEKLLQT CFSSPADDSM DR
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to, and receive a free "I Love Antibodies" mug.


HSPBP1 inhibits HSPA1A chaperone activity by changing the conformation of the ATP-binding domain of HSPA1A and interfering with ATP binding. Interferes with ubiquitination mediated by STUB1 and inhibits chaperone-assisted degradation of immature CFTR.


Graner, M.W., et al. Cancer Sci. 100(10):1870-1879(2009)
Evdonin, A., et al. Biol. Cell 101(6):351-360(2009)
Souza, A.P., et al. Cell Stress Chaperones 14(3):301-310(2009)
Howarth, J.L., et al. J. Neurochem. 108(4):945-951(2009)
Snyers, L., et al. Biochem. Biophys. Res. Commun. 368(3):767-771(2008)

Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at

Cat# AP14772A
Availability: Inquire
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions