Register or Login
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Signal Transduction   >   SPAG6 Antibody (C-term)   

SPAG6 Antibody (C-term)

Peptide Affinity Purified Rabbit Polyclonal Antibody (Pab)

  • WB - SPAG6 Antibody (C-term) AP20398b
    SPAG6 Antibody (C-term) (Cat. #AP20398b) western blot analysis in MDA-MB453 cell line lysates (35ug/lane).This demonstrates the SPAG6 antibody detected the SPAG6 protein (arrow).
Product Information
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
Primary Accession O75602
Other Accession Q9JLI7
Reactivity Human
Predicted Mouse
Host Rabbit
Clonality Polyclonal
Isotype Rabbit Ig
Antigen Region 422-448 aa
Additional Information
Other Names Sperm-associated antigen 6, Protein PF16 homolog, Repro-SA-1, Sperm flagellar protein, SPAG6, PF16
Target/Specificity This SPAG6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 422-448 amino acids from the C-terminal region of human SPAG6.
Dilution WB~~1:1000
Format Purified polyclonal antibody supplied in PBS with 0.09% (W/V) sodium azide. This antibody is purified through a protein A column, followed by peptide affinity purification.
StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
PrecautionsSPAG6 Antibody (C-term) is for research use only and not for use in diagnostic or therapeutic procedures.
Protein Information
Name SPAG6
Synonyms PF16
Function Important for structural integrity of the central apparatus in the sperm tail and for flagellar motility.
Cellular Location Cytoplasm, cytoskeleton. Cell projection, cilium, flagellum. Note=Associated with microtubules Detected on the sperm flagellum
Tissue Location Highly expressed in testis. EMBL; AF079363; AAC32590.1; -; mRNA EMBL; AL080136; CAB45730.1; -; mRNA EMBL; CR533552; CAG38583.1; -; mRNA EMBL; AK289903; BAF82592.1; -; mRNA EMBL; AK302194; BAG63556.1; -; mRNA EMBL; AL158211; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; AL513128; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; CH471072; EAW86146.1; -; Genomic_DNA EMBL; BC030585; AAH30585.1; -; mRNA CCDS; CCDS58071.1; -. [O75602-5] CCDS; CCDS7139.1; -. [O75602-1] CCDS; CCDS7140.1; -. [O75602-2] PIR; T12521; T12521 RefSeq; NP_001240783.1; NM_001253854.1. [O75602-5] RefSeq; NP_001240784.1; NM_001253855.1 RefSeq; NP_036575.1; NM_012443.3. [O75602-1] RefSeq; NP_758442.1; NM_172242.2. [O75602-2] UniGene; Hs.655170; - ProteinModelPortal; O75602; - BioGrid; 114945; 2 IntAct; O75602; 1 STRING; 9606.ENSP00000365811; - iPTMnet; O75602; - PhosphoSitePlus; O75602; - BioMuta; SPAG6; - jPOST; O75602; - PaxDb; O75602; - PeptideAtlas; O75602; - PRIDE; O75602; - ProteomicsDB; 50107; - ProteomicsDB; 50108; -. [O75602-2] ProteomicsDB; 50109; -. [O75602-3] ProteomicsDB; 50110; -. [O75602-4] DNASU; 9576; - Ensembl; ENST00000313311; ENSP00000323599; ENSG00000077327. [O75602-2] Ensembl; ENST00000376624; ENSP00000365811; ENSG00000077327. [O75602-1] Ensembl; ENST00000538630; ENSP00000441325; ENSG00000077327. [O75602-5] GeneID; 9576; - KEGG; hsa:9576; - UCSC; uc001iri.4; human. [O75602-1] CTD; 9576; - DisGeNET; 9576; - EuPathDB; HostDB:ENSG00000077327.15; - GeneCards; SPAG6; - HGNC; HGNC:11215; SPAG6 HPA; HPA038440; - MIM; 605730; gene neXtProt; NX_O75602; - OpenTargets; ENSG00000077327; - PharmGKB; PA36051; - eggNOG; KOG0166; Eukaryota eggNOG; COG5064; LUCA GeneTree; ENSGT00900000141099; - HOVERGEN; HBG055326; - InParanoid; O75602; - OMA; GRHTPDH; - OrthoDB; 577008at2759; - PhylomeDB; O75602; - TreeFam; TF328894; - SignaLink; O75602; - ChiTaRS; SPAG6; human GeneWiki; SPAG6; - GenomeRNAi; 9576; - PRO; PR:O75602; - Proteomes; UP000005640; Chromosome 10 Bgee; ENSG00000077327; Expressed in 96 organ(s), highest expression level in bronchial epithelial cell ExpressionAtlas; O75602; baseline and differential Genevisible; O75602; HS GO; GO:0005930; C:axoneme; TAS:ProtInc GO; GO:0005874; C:microtubule; IEA:UniProtKB-KW GO; GO:0015630; C:microtubule cytoskeleton; IDA:LIFEdb GO; GO:0031514; C:motile cilium; IEA:UniProtKB-SubCell GO; GO:0005634; C:nucleus; HDA:UniProtKB GO; GO:0030030; P:cell projection organization; IEA:UniProtKB-KW GO; GO:0007286; P:spermatid development; TAS:ProtInc Gene3D;; -; 2 InterPro; IPR011989; ARM-like InterPro; IPR016024; ARM-type_fold InterPro; IPR000225; Armadillo Pfam; PF00514; Arm; 4 SMART; SM00185; ARM; 7 SUPFAM; SSF48371; SSF48371; 1 2: Evidence at transcript level; Alternative splicing; Cell projection; Cilium; Cilium biogenesis/degradation; Complete proteome; Cytoplasm; Cytoskeleton; Flagellum; Microtubule; Polymorphism; Reference proteome; Repeat CHAIN 1 509 Sperm-associated antigen 6 /FTId=PRO_0000072095 REPEAT 31 70 ARM 1 REPEAT 73 112 ARM 2 REPEAT 115 154 ARM 3 REPEAT 157 196 ARM 4 REPEAT 199 238 ARM 5 REPEAT 241 280 ARM 6 REPEAT 325 365 ARM 7 REPEAT 368 409 ARM 8 VAR_SEQ 1 39 MSQRQVLQVFEQYQKARTQFVQMVAELATRPQNIETLQN -> MHSLTMDLWIPNGQ (in isoform 5) /FTId=VSP_045337 VAR_SEQ 41 41 G -> GEPGARTPVAPRALSPRRLRPAALPVELLGSRSVGT GVRKSIHSFQRVFGGQAERVKLPDGCGRCALSLFPSSLHTG (in isoform 3). /FTId=VSP_013442 VAR_SEQ 97 335 Missing (in isoform 4). /FTId=VSP_013443 VAR_SEQ 441 458 PHDSKARRLFVTSGGLKK -> FPWIFRYTSAEGGQLSTT (in isoform 2) /FTId=VSP_013444 VAR_SEQ 459 509 Missing (in isoform 2) /FTId=VSP_013445 VARIANT 106 106 V -> L (in a breast cancer sample; somatic mutation) /FTId=VAR_035659 VARIANT 216 216 Q -> R (in dbSNP:rs7074847) /FTId=VAR_024282 CONFLICT 60 60 T -> I (in Ref. 7; AAH30585) CONFLICT 161 161 Q -> R (in Ref. 3; CAG38583) CONFLICT 185 185 R -> G (in Ref. 7; AAH30585) CONFLICT 195 195 A -> V (in Ref. 7; AAH30585) SEQUENCE 509 AA; 55476 MW; 03D868E31D3883E1 CRC64; MSQRQVLQVF EQYQKARTQF VQMVAELATR PQNIETLQNA GVMSLLRTLL LDVVPTIQQT AALALGRLAN YNDDLAEAVV KCDILPQLVY SLAEQNRFYK KAAAFVLRAV GKHSPQLAQA IVDCGALDTL VICLEDFDPG VKEAAAWALR YIARHNAELS QAVVDAGAVP LLVLCIQEPE IALKRIAASA LSDIAKHSPE LAQTVVDAGA VAHLAQMILN PDAKLKHQIL SALSQVSKHS VDLAEMVVEA EIFPVVLTCL KDKDEYVKKN ASTLIREIAK HTPELSQLVV NAGGVAAVID CIGSCKGNTR LPGIMMLGYV AAHSENLAMA VIISKGVPQL SVCLSEEPED HIKAAAAWAL GQIGRHTPEH ARAVAVTNTL PVLLSLYMST ESSEDLQVKS KKAIKNILQK CTYLPALEPF LYDAPPNILK HVVGQFSKVL PHDSKARRLF VTSGGLKKVQ EIKAEPGSLL QEYINSINSC YPEEIVRYYS PGYSDTLLQR VDSYQPLNN
Research Areas
Citations ( 0 )


Important for structural integrity of the central apparatus in the sperm tail and for flagellar motility (By similarity).

Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at

$ 325.00
$ 109.00
Cat# AP20398b
Availability: In Stock
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions