Register or Login
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Signal Transduction   >   OLFM3 Antibody (N-term)   

OLFM3 Antibody (N-term)

Peptide Affinity Purified Rabbit Polyclonal Antibody (Pab)

  • WB - OLFM3 Antibody (N-term) AP20399a
    All lanes : Anti-OLFM3 Antibody (N-term) at 1:1000 dilution Lane 1: 293 whole cell lysate Lane 2: Y79 whole cell lysate Lysates/proteins at 20 µg per lane. Secondary Goat Anti-Rabbit IgG, (H+L), Peroxidase conjugated at 1/10000 dilution. Predicted band size : 55 kDa Blocking/Dilution buffer: 5% NFDM/TBST.
  • WB - OLFM3 Antibody (N-term) AP20399a
    OLFM3 Antibody (N-term) (Cat. #AP20399a) western blot analysis in mouse cerebellum tissue lysates (35ug/lane).This demonstrates the OLFM3 antibody detected the OLFM3 protein (arrow).
Product Information
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
Primary Accession Q96PB7
Other Accession P63057, P63056
Reactivity Human, Mouse
Predicted Rat
Host Rabbit
Clonality Polyclonal
Isotype Rabbit Ig
Antigen Region 114-142 aa
Additional Information
Other Names Noelin-3, Olfactomedin-3, Optimedin, OLFM3, NOE3
Target/Specificity This OLFM3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 114-142 amino acids from the N-terminal region of human OLFM3.
Dilution WB~~1:1000
Format Purified polyclonal antibody supplied in PBS with 0.09% (W/V) sodium azide. This antibody is purified through a protein A column, followed by peptide affinity purification.
StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
PrecautionsOLFM3 Antibody (N-term) is for research use only and not for use in diagnostic or therapeutic procedures.
Protein Information
Name OLFM3
Synonyms NOE3
Cellular Location Secreted. Cell junction, synapse
Tissue Location In the eye, expressed in trabecular meshwork and neural retina; in non-ocular tissues, expressed in brain and lung. EMBL; AF397392; AAK97473.1; -; mRNA EMBL; AF397393; AAK97474.1; -; mRNA EMBL; AF397394; AAK97475.1; -; mRNA EMBL; AF397395; AAK97476.1; -; mRNA EMBL; AF397396; AAK97477.1; -; mRNA EMBL; AF397397; AAK97478.1; -; mRNA EMBL; AY358722; AAQ89084.1; -; mRNA EMBL; AK095724; BAG53115.1; -; mRNA EMBL; AL356280; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; AL359760; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; CH471097; EAW72922.1; -; Genomic_DNA EMBL; BC022531; AAH22531.1; -; mRNA EMBL; BK001429; DAA01551.1; -; Genomic_DNA EMBL; BK001429; DAA01553.1; -; Genomic_DNA EMBL; BK001429; DAA01554.1; -; Genomic_DNA EMBL; BK001429; DAA01555.1; -; Genomic_DNA EMBL; BK001429; DAA01556.1; -; Genomic_DNA CCDS; CCDS30781.1; -. [Q96PB7-3] CCDS; CCDS72832.1; -. [Q96PB7-1] RefSeq; NP_001275750.1; NM_001288821.1. [Q96PB7-1] RefSeq; NP_001275752.1; NM_001288823.1. [Q96PB7-5] RefSeq; NP_477518.2; NM_058170.3. [Q96PB7-3] RefSeq; XP_016855729.1; XM_017000240.1. [Q96PB7-5] UniGene; Hs.484475; - ProteinModelPortal; Q96PB7; - SMR; Q96PB7; - BioGrid; 125601; 10 IntAct; Q96PB7; 6 STRING; 9606.ENSP00000359121; - iPTMnet; Q96PB7; - PhosphoSitePlus; Q96PB7; - DMDM; 20139068; - PaxDb; Q96PB7; - PeptideAtlas; Q96PB7; - PRIDE; Q96PB7; - ProteomicsDB; 77652; - ProteomicsDB; 77653; -. [Q96PB7-2] ProteomicsDB; 77654; -. [Q96PB7-3] ProteomicsDB; 77655; -. [Q96PB7-4] ProteomicsDB; 77656; -. [Q96PB7-5] ProteomicsDB; 77657; -. [Q96PB7-6] DNASU; 118427; - Ensembl; ENST00000338858; ENSP00000345192; ENSG00000118733. [Q96PB7-1] Ensembl; ENST00000370103; ENSP00000359121; ENSG00000118733. [Q96PB7-3] Ensembl; ENST00000536598; ENSP00000443471; ENSG00000118733. [Q96PB7-6] GeneID; 118427; - KEGG; hsa:118427; - UCSC; uc001duf.4; human. [Q96PB7-1] CTD; 118427; - DisGeNET; 118427; - EuPathDB; HostDB:ENSG00000118733.16; - GeneCards; OLFM3; - H-InvDB; HIX0000823; - HGNC; HGNC:17990; OLFM3 HPA; HPA050297; - MIM; 607567; gene neXtProt; NX_Q96PB7; - OpenTargets; ENSG00000118733; - PharmGKB; PA31917; - eggNOG; ENOG410INP6; Eukaryota eggNOG; ENOG410ZVS0; LUCA GeneTree; ENSGT00760000119005; - HOGENOM; HOG000232069; - HOVERGEN; HBG061751; - InParanoid; Q96PB7; - OMA; VMKSWNT; - OrthoDB; EOG091G05HN; - PhylomeDB; Q96PB7; - TreeFam; TF315964; - ChiTaRS; OLFM3; human GeneWiki; OLFM3; - GenomeRNAi; 118427; - PRO; PR:Q96PB7; - Proteomes; UP000005640; Chromosome 1 Bgee; ENSG00000118733; - CleanEx; HS_OLFM3; - ExpressionAtlas; Q96PB7; baseline and differential Genevisible; Q96PB7; HS GO; GO:0032281; C:AMPA glutamate receptor complex; IEA:Ensembl GO; GO:0030054; C:cell junction; IEA:UniProtKB-KW GO; GO:0005615; C:extracellular space; IEA:Ensembl GO; GO:0005794; C:Golgi apparatus; IEA:Ensembl GO; GO:0045202; C:synapse; IEA:UniProtKB-SubCell GO; GO:0042462; P:eye photoreceptor cell development; IEA:Ensembl InterPro; IPR031216; Noelin-3 InterPro; IPR022082; Noelin_dom InterPro; IPR003112; Olfac-like_dom InterPro; IPR011044; Quino_amine_DH_bsu PANTHER; PTHR23192:SF36; PTHR23192:SF36; 1 Pfam; PF12308; Noelin-1; 1 Pfam; PF02191; OLF; 1 SMART; SM00284; OLF; 1 SUPFAM; SSF50969; SSF50969; 3 PROSITE; PS51132; OLF; 1 1: Evidence at protein level; Alternative splicing; Cell junction; Coiled coil; Complete proteome; Disulfide bond; Glycoprotein; Reference proteome; Secreted; Signal; Synapse SIGNAL 1 23 CHAIN 24 478 Noelin-3 /FTId=PRO_0000020080 DOMAIN 218 470 Olfactomedin-like. {ECO:0000255|PROSITE- ProRule:PRU00446} COILED 77 217 CARBOHYD 33 33 N-linked (GlcNAc...) asparagine CARBOHYD 95 95 N-linked (GlcNAc...) asparagine CARBOHYD 179 179 N-linked (GlcNAc...) asparagine CARBOHYD 299 299 N-linked (GlcNAc...) asparagine CARBOHYD 465 465 N-linked (GlcNAc...) asparagine DISULFID 219 401 {ECO:0000255|PROSITE-ProRule:PRU00446} VAR_SEQ 1 95 Missing (in isoform 5 and isoform 6) {ECO:0000303|Ref.1} /FTId=VSP_003770 VAR_SEQ 1 43 MSPPLLKLGAVLSTMAMISNWMSQTLPSLVGLNTTRLSTPD TL -> MQATSNLLNLLLLSLFAGLDPSK (in isoform 3 and isoform 4) {ECO:0000303|PubMed:15489334, ECO:0000303|Ref.1} /FTId=VSP_003769 VAR_SEQ 218 235 TCGKLMKITGPVTVKTSG -> IDLKKRKEEEKRQQKGEA (in isoform 2, isoform 4 and isoform 6) {ECO:0000303|Ref.1} /FTId=VSP_003771 VAR_SEQ 236 478 Missing (in isoform 2, isoform 4 and isoform 6). {ECO:0000303|Ref.1} /FTId=VSP_003772 CONFLICT 88 88 Q -> K (in Ref. 6; AAH22531) CONFLICT 454 454 Y -> C (in Ref. 6; AAH22531) SEQUENCE 478 AA; 54930 MW; 02EAAF58741489E5 CRC64; MSPPLLKLGA VLSTMAMISN WMSQTLPSLV GLNTTRLSTP DTLTQISPKE GWQVYSSAQD PDGRCICTVV APEQNLCSRD AKSRQLRQLL EKVQNMSQSI EVLNLRTQRD FQYVLKMETQ MKGLKAKFRQ IEDDRKTLMT KHFQELKEKM DELLPLIPVL EQYKTDAKLI TQFKEEIRNL SAVLTGIQEE IGAYDYEELH QRVLSLETRL RDCMKKLTCG KLMKITGPVT VKTSGTRFGA WMTDPLASEK NNRVWYMDSY TNNKIVREYK SIADFVSGAE SRTYNLPFKW AGTNHVVYNG SLYFNKYQSN IIIKYSFDMG RVLAQRSLEY AGFHNVYPYT WGGFSDIDLM ADEIGLWAVY ATNQNAGNIV ISQLNQDTLE VMKSWSTGYP KRSAGESFMI CGTLYVTNSH LTGAKVYYSY STKTSTYEYT DIPFHNQYFH ISMLDYNARD RALYAWNNGH QVLFNVTLFH IIKTEDDT
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to, and receive a free "I Love Antibodies" mug.


The function of this protein remains unknown.

Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at

$ 325.00
$ 109.00
Cat# AP20399a
Availability: In Stock
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions