Register or Login
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Microbiology   >   BTBD1 Antibody (Center)   

BTBD1 Antibody (Center)

Purified Rabbit Polyclonal Antibody (Pab)

  • WB - BTBD1 Antibody (Center) AP7323c
    Western blot analysis of BTBD1 antibody (Center) (Cat.#AP7323c) in 293 cell line lysates (35ug/lane). BTBD1 (arrow) was detected using the purified Pab.
  • WB - BTBD1 Antibody (Center) AP7323c
    Western blot analysis of BTBD1 antibody (Center) (Cat.#AP7323c) in mouse cerebellum tissue lysates (35ug/lane). BTBD1 (arrow) was detected using the purified Pab.
  • FC - BTBD1 Antibody (Center) AP7323c
    BTBD1 Antibody (Center) (Cat. #AP7323c) flow cytometric analysis of 293 cells (right histogram) compared to a negative control cell (left histogram).FITC-conjugated goat-anti-rabbit secondary antibodies were used for the analysis.
Product Information
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
Primary Accession Q9H0C5
Other Accession P58544
Reactivity Human, Mouse
Host Rabbit
Clonality Polyclonal
Isotype Rabbit Ig
Antigen Region 295-322 aa
Additional Information
Other Names BTB/POZ domain-containing protein 1, Hepatitis C virus NS5A-transactivated protein 8, HCV NS5A-transactivated protein 8, BTBD1, C15orf1, NS5ATP8
Target/Specificity This BTBD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 295-322 amino acids from the Central region of human BTBD1.
Dilution WB~~1:1000
Format Purified polyclonal antibody supplied in PBS with 0.09% (W/V) sodium azide. This antibody is prepared by Saturated Ammonium Sulfate (SAS) precipitation followed by dialysis against PBS.
StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
PrecautionsBTBD1 Antibody (Center) is for research use only and not for use in diagnostic or therapeutic procedures.
Protein Information
Name BTBD1
Synonyms C15orf1, NS5ATP8
Function Probable substrate-specific adapter of an E3 ubiquitin- protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (PubMed:14528312). Seems to regulate expression levels and/or subnuclear distribution of TOP1, via an unknown mechanism (By similarity). May play a role in mesenchymal differentiation where it promotes myogenic differentiation and suppresses adipogenesis (By similarity).
Cellular Location Cytoplasm. Note=Localizes to punctate or elongated cytoplasmic bodies.
Tissue Location Ubiquitous; highest levels in testes, heart and skeletal muscle. EMBL; AL136853; CAB66787.1; -; mRNA EMBL; AF355402; AAK25825.1; -; mRNA EMBL; AF257241; AAK17068.1; -; mRNA EMBL; AK000731; BAA91345.1; -; mRNA EMBL; AF529369; AAQ09603.1; -; mRNA EMBL; AC022558; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; AC024270; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; BC028097; AAH28097.1; -; mRNA CCDS; CCDS10322.1; -. [Q9H0C5-1] CCDS; CCDS32313.1; -. [Q9H0C5-2] RefSeq; NP_001011885.1; NM_001011885.1. [Q9H0C5-2] RefSeq; NP_079514.1; NM_025238.3. [Q9H0C5-1] UniGene; Hs.459149; - ProteinModelPortal; Q9H0C5; - SMR; Q9H0C5; - BioGrid; 119740; 62 IntAct; Q9H0C5; 17 MINT; Q9H0C5; - STRING; 9606.ENSP00000261721; - iPTMnet; Q9H0C5; - PhosphoSitePlus; Q9H0C5; - BioMuta; BTBD1; - DMDM; 20137477; - EPD; Q9H0C5; - jPOST; Q9H0C5; - MaxQB; Q9H0C5; - PaxDb; Q9H0C5; - PeptideAtlas; Q9H0C5; - PRIDE; Q9H0C5; - ProteomicsDB; 80253; - TopDownProteomics; Q9H0C5-1; -. [Q9H0C5-1] DNASU; 53339; - Ensembl; ENST00000261721; ENSP00000261721; ENSG00000064726. [Q9H0C5-1] Ensembl; ENST00000379403; ENSP00000368713; ENSG00000064726. [Q9H0C5-2] GeneID; 53339; - KEGG; hsa:53339; - UCSC; uc002bjn.4; human. [Q9H0C5-1] CTD; 53339; - DisGeNET; 53339; - EuPathDB; HostDB:ENSG00000064726.9; - GeneCards; BTBD1; - HGNC; HGNC:1120; BTBD1 HPA; HPA067671; - MIM; 608530; gene neXtProt; NX_Q9H0C5; - OpenTargets; ENSG00000064726; - PharmGKB; PA25438; - eggNOG; KOG2075; Eukaryota eggNOG; ENOG410XQ3X; LUCA GeneTree; ENSGT00940000156756; - HOGENOM; HOG000293364; - HOVERGEN; HBG050743; - InParanoid; Q9H0C5; - KO; K10477; - OMA; TIDKNTM; - OrthoDB; 590115at2759; - PhylomeDB; Q9H0C5; - TreeFam; TF106482; - Reactome; R-HSA-8951664; Neddylation Reactome; R-HSA-983168; Antigen processing: Ubiquitination & Proteasome degradation UniPathway; UPA00143; - ChiTaRS; BTBD1; human GeneWiki; BTBD1; - GenomeRNAi; 53339; - PRO; PR:Q9H0C5; - Proteomes; UP000005640; Chromosome 15 Bgee; ENSG00000064726; Expressed in 239 organ(s), highest expression level in quadriceps femoris ExpressionAtlas; Q9H0C5; baseline and differential Genevisible; Q9H0C5; HS GO; GO:0005829; C:cytosol; IBA:GO_Central GO; GO:0000932; C:P-body; IDA:UniProtKB GO; GO:0032991; C:protein-containing complex; IDA:LIFEdb GO; GO:0007517; P:muscle organ development; IEA:UniProtKB-KW GO; GO:0022008; P:neurogenesis; IBA:GO_Central GO; GO:0043687; P:post-translational protein modification; TAS:Reactome GO; GO:0016567; P:protein ubiquitination; IEA:UniProtKB-UniPathway GO; GO:0043393; P:regulation of protein binding; NAS:UniProtKB Gene3D;; -; 1 InterPro; IPR011705; BACK InterPro; IPR000210; BTB/POZ_dom InterPro; IPR012983; PHR InterPro; IPR038648; PHR_sf InterPro; IPR011333; SKP1/BTB/POZ_sf Pfam; PF07707; BACK; 1 Pfam; PF00651; BTB; 1 Pfam; PF08005; PHR; 1 SMART; SM00875; BACK; 1 SMART; SM00225; BTB; 1 SUPFAM; SSF54695; SSF54695; 1 PROSITE; PS50097; BTB; 1 1: Evidence at protein level; Alternative splicing; Complete proteome; Cytoplasm; Differentiation; Methylation; Myogenesis; Reference proteome; Ubl conjugation pathway CHAIN 1 482 BTB/POZ domain-containing protein 1 /FTId=PRO_0000186208 DOMAIN 69 145 BTB. {ECO:0000255|PROSITE- ProRule:PRU00037} DOMAIN 184 284 BACK. COMPBIAS 25 31 Poly-Pro. MOD_RES 79 79 Omega-N-methylarginine VAR_SEQ 353 386 FTVNRRISIVGFGLYGSIHGPTDYQVNIQIIEYE -> SLN MRKSKPWDRMIPALVVMGQLTHSGSCSRNP (in isoform 2). /FTId=VSP_047146 VAR_SEQ 387 482 Missing (in isoform 2). /FTId=VSP_047147 CONFLICT 406 406 T -> A (in Ref. 5; BAA91345) CONFLICT 422 422 C -> G (in Ref. 2; AAK25825) CONFLICT 429 429 L -> P (in Ref. 5; BAA91345) SEQUENCE 482 AA; 52771 MW; 525A49E01728AFF0 CRC64; MASLGPAAAG EQASGAEAEP GPAGPPPPPS PSSLGPLLPL QREPLYNWQA TKASLKERFA FLFNSELLSD VRFVLGKGRG AAAAGGPQRI PAHRFVLAAG SAVFDAMFNG GMATTSAEIE LPDVEPAAFL ALLRFLYSDE VQIGPETVMT TLYTAKKYAV PALEAHCVEF LTKHLRADNA FMLLTQARLF DEPQLASLCL DTIDKSTMDA ISAEGFTDID IDTLCAVLER DTLSIRESRL FGAVVRWAEA ECQRQQLPVT FGNKQKVLGK ALSLIRFPLM TIEEFAAGPA QSGILSDREV VNLFLHFTVN PKPRVEYIDR PRCCLRGKEC CINRFQQVES RWGYSGTSDR IRFTVNRRIS IVGFGLYGSI HGPTDYQVNI QIIEYEKKQT LGQNDTGFSC DGTANTFRVM FKEPIEILPN VCYTACATLK GPDSHYGTKG LKKVVHETPA ASKTVFFFFS SPGNNNGTSI EDGQIPEIIF YT
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to, and receive a free "I Love Antibodies" mug.


BTBD1 binds topoisomerase I. The N-terminus contains a proline-rich region and a BTB/POZ domain (broad-complex, Tramtrack and bric a brac/Pox virus and Zinc finger), both of which are typically involved in protein-protein interactions. Subcellularly, the protein localizes to cytoplasmic bodies.


Pisani,D.F., Cabane,C. Cell Death Differ. 11 (11), 1157-1165 (2004)
Xu,L., Yang,L. Exp. Cell Res. 288 (1), 84-93 (2003)
Xu,L., Yang,L. BMC Genomics 3 (1), 1 (2002)

Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at

$ 325.00
$ 109.00
Cat# AP7323c
Availability: In Stock
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions