Register or Login
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   TGOLN2 Antibody (C-term)   

TGOLN2 Antibody (C-term)

Peptide Affinity Purified Rabbit Polyclonal Antibody (Pab)

  • WB - TGOLN2 Antibody (C-term) AP8955b
    Anti-TGOLN2 Antibody (C-term) at 1:1000 dilution + MCF-7 whole cell lysate Lysates/proteins at 20 µg per lane. Secondary Goat Anti-Rabbit IgG, (H+L), Peroxidase conjugated at 1/10000 dilution. Predicted band size : 51 kDa Blocking/Dilution buffer: 5% NFDM/TBST.
  • FC - TGOLN2 Antibody (C-term) AP8955b
    TGOLN2 Antibody (C-term) (Cat.#AP8955b) flow cytometry analysis of MDA-MB231 cells (bottom histogram) compared to a negative control cell (top histogram). FITC-conjugated goat-anti-rabbit secondary antibodies were used for the analysis.
Product Information
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
Primary Accession O43493
Other Accession P19814, Q62314, Q62313
Reactivity Human
Predicted Mouse
Host Rabbit
Clonality Polyclonal
Isotype Rabbit Ig
Antigen Region 399-427 aa
Additional Information
Other Names Trans-Golgi network integral membrane protein 2, TGN38 homolog, TGN46, TGN48, Trans-Golgi network protein TGN51, TGOLN2, TGN46, TGN51
Target/Specificity This TGOLN2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 399-427 amino acids from the C-terminal region of human TGOLN2.
Dilution WB~~1:1000
Format Purified polyclonal antibody supplied in PBS with 0.09% (W/V) sodium azide. This antibody is purified through a protein A column, followed by peptide affinity purification.
StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
PrecautionsTGOLN2 Antibody (C-term) is for research use only and not for use in diagnostic or therapeutic procedures.
Protein Information
Synonyms TGN46, TGN51
Function May be involved in regulating membrane traffic to and from trans-Golgi network.
Cellular Location Cell membrane; Single-pass type I membrane protein. Golgi apparatus, trans-Golgi network membrane; Single- pass type I membrane protein. Note=Primarily in trans-Golgi network. Cycles between the trans-Golgi network and the cell surface returning via endosomes
Tissue Location Isoform TGN46 is widely expressed. Isoform TGN51 is more abundant in fetal lung and kidney. Isoform TGN48 is barely expressed in embryonic kidney and promyelocytic cells EMBL; AF029316; AAB96906.1; -; Genomic_DNA EMBL; AF029313; AAB96906.1; JOINED; Genomic_DNA EMBL; AF029314; AAB96906.1; JOINED; Genomic_DNA EMBL; AF029315; AAB96906.1; JOINED; Genomic_DNA EMBL; AF029316; AAB96907.1; -; Genomic_DNA EMBL; AF029313; AAB96907.1; JOINED; Genomic_DNA EMBL; AF029314; AAB96907.1; JOINED; Genomic_DNA EMBL; AF029315; AAB96907.1; JOINED; Genomic_DNA EMBL; AF029316; AAB96908.1; -; Genomic_DNA EMBL; AF029313; AAB96908.1; JOINED; Genomic_DNA EMBL; AF029314; AAB96908.1; JOINED; Genomic_DNA EMBL; AF029315; AAB96908.1; JOINED; Genomic_DNA EMBL; U62390; AAC39539.1; -; mRNA EMBL; AF027515; AAC39541.1; -; mRNA EMBL; AF027516; AAC39542.1; -; mRNA EMBL; X94333; CAA64002.1; -; mRNA EMBL; AK126465; BAC86559.1; -; mRNA EMBL; AK222829; BAD96549.1; -; mRNA EMBL; AK223063; BAD96783.1; -; mRNA EMBL; AK312479; BAG35383.1; -; mRNA EMBL; BX640868; CAE45926.1; -; mRNA EMBL; AC093162; AAY24095.1; -; Genomic_DNA EMBL; CH471053; EAW99535.1; -; Genomic_DNA EMBL; CH471053; EAW99536.1; -; Genomic_DNA EMBL; CH471053; EAW99539.1; -; Genomic_DNA EMBL; BC008461; AAH08461.1; -; mRNA EMBL; BC028219; AAH28219.1; -; mRNA CCDS; CCDS46351.1; -. [O43493-2] CCDS; CCDS56126.1; -. [O43493-3] CCDS; CCDS56127.1; -. [O43493-4] RefSeq; NP_001193769.1; NM_001206840.1 RefSeq; NP_001193770.1; NM_001206841.1 RefSeq; NP_001193773.1; NM_001206844.1. [O43493-4] RefSeq; NP_006455.2; NM_006464.3. [O43493-2] UniGene; Hs.593382; - BioGrid; 115864; 52 IntAct; O43493; 424 MINT; O43493; - STRING; 9606.ENSP00000386443; - iPTMnet; O43493; - PhosphoSitePlus; O43493; - BioMuta; TGOLN2; - EPD; O43493; - PaxDb; O43493; - PeptideAtlas; O43493; - PRIDE; O43493; - ProteomicsDB; 48976; - ProteomicsDB; 48977; -. [O43493-2] ProteomicsDB; 48978; -. [O43493-3] ProteomicsDB; 48979; -. [O43493-4] ProteomicsDB; 48980; -. [O43493-5] ProteomicsDB; 48981; -. [O43493-6] DNASU; 10618; - Ensembl; ENST00000282120; ENSP00000282120; ENSG00000152291. [O43493-1] Ensembl; ENST00000377386; ENSP00000366603; ENSG00000152291. [O43493-2] Ensembl; ENST00000398263; ENSP00000381312; ENSG00000152291. [O43493-4] Ensembl; ENST00000409232; ENSP00000386443; ENSG00000152291. [O43493-3] Ensembl; ENST00000444342; ENSP00000391190; ENSG00000152291. [O43493-5] GeneID; 10618; - KEGG; hsa:10618; - UCSC; uc002soz.4; human. [O43493-1] CTD; 10618; - DisGeNET; 10618; - EuPathDB; HostDB:ENSG00000152291.13; - GeneCards; TGOLN2; - H-InvDB; HIX0022878; - HGNC; HGNC:15450; TGOLN2 HPA; CAB011489; - HPA; HPA012609; - HPA; HPA012723; - MIM; 603062; gene neXtProt; NX_O43493; - OpenTargets; ENSG00000152291; - PharmGKB; PA37959; - eggNOG; ENOG410IXPE; Eukaryota eggNOG; ENOG410XUUR; LUCA GeneTree; ENSGT00530000064712; - HOGENOM; HOG000089969; - HOVERGEN; HBG108564; - InParanoid; O43493; - OMA; KTQKDSP; - OrthoDB; EOG091G02UO; - PhylomeDB; O43493; - Reactome; R-HSA-381426; Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) Reactome; R-HSA-432722; Golgi Associated Vesicle Biogenesis Reactome; R-HSA-6811440; Retrograde transport at the Trans-Golgi-Network Reactome; R-HSA-8856825; Cargo recognition for clathrin-mediated endocytosis Reactome; R-HSA-8856828; Clathrin-mediated endocytosis Reactome; R-HSA-8957275; Post-translational protein phosphorylation ChiTaRS; TGOLN2; human GeneWiki; TGOLN2; - GenomeRNAi; 10618; - PRO; PR:O43493; - Proteomes; UP000005640; Chromosome 2 Bgee; ENSG00000152291; - ExpressionAtlas; O43493; baseline and differential Genevisible; O43493; HS GO; GO:0030665; C:clathrin-coated vesicle membrane; TAS:Reactome GO; GO:0005829; C:cytosol; IEA:GOC GO; GO:0005788; C:endoplasmic reticulum lumen; TAS:Reactome GO; GO:0005768; C:endosome; IBA:GO_Central GO; GO:0005794; C:Golgi apparatus; IDA:HPA GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW GO; GO:0005654; C:nucleoplasm; IDA:HPA GO; GO:0005886; C:plasma membrane; TAS:Reactome GO; GO:0005802; C:trans-Golgi network; IDA:MGI GO; GO:0030140; C:trans-Golgi network transport vesicle; IBA:GO_Central GO; GO:0030133; C:transport vesicle; TAS:ProtInc GO; GO:0044267; P:cellular protein metabolic process; TAS:Reactome GO; GO:0006895; P:Golgi to endosome transport; IBA:GO_Central GO; GO:0061024; P:membrane organization; TAS:Reactome GO; GO:0043687; P:post-translational protein modification; TAS:Reactome InterPro; IPR026084; TGN38 PANTHER; PTHR23211; PTHR23211; 1 1: Evidence at protein level; Alternative splicing; Cell membrane; Complete proteome; Glycoprotein; Golgi apparatus; Membrane; Phosphoprotein; Polymorphism; Reference proteome; Repeat; Signal; Transmembrane; Transmembrane helix SIGNAL 1 21 CHAIN 22 479 Trans-Golgi network integral membrane protein 2 /FTId=PRO_0000022486 TOPO_DOM 22 381 Extracellular. TRANSMEM 382 402 Helical. TOPO_DOM 403 479 Cytoplasmic. REPEAT 54 67 1 REPEAT 68 81 2 REPEAT 82 95 3 REPEAT 96 109 4 REPEAT 110 123 5 REPEAT 124 137 6 REPEAT 138 151 7 REPEAT 152 165 8 REPEAT 166 179 9 REPEAT 180 193 10 REPEAT 194 207 11 REPEAT 208 221 12 REPEAT 222 234 13 REPEAT 235 249 14 REGION 54 249 14 X 14 AA tandem repeats MOTIF 430 433 Endocytosis signal; in isoform TGN46 and isoform TGN48 MOTIF 437 440 Endocytosis signal; in isoform TGN51 MOTIF 460 463 Endocytosis signal; in isoform TGN51 MOD_RES 71 71 Phosphoserine; by FAM20C MOD_RES 221 221 Phosphoserine; by FAM20C MOD_RES 298 298 Phosphoserine; by FAM20C MOD_RES 302 302 Phosphothreonine; by FAM20C MOD_RES 351 351 Phosphoserine; by FAM20C CARBOHYD 39 39 N-linked (GlcNAc...) asparagine CARBOHYD 82 82 N-linked (GlcNAc...) asparagine CARBOHYD 96 96 N-linked (GlcNAc...) asparagine CARBOHYD 152 152 N-linked (GlcNAc...) asparagine CARBOHYD 180 180 N-linked (GlcNAc...) asparagine CARBOHYD 208 208 N-linked (GlcNAc...) asparagine CARBOHYD 222 222 N-linked (GlcNAc...) asparagine CARBOHYD 373 373 N-linked (GlcNAc...) asparagine CARBOHYD 377 377 N-linked (GlcNAc...) asparagine VAR_SEQ 64 161 Missing (in isoform 6) /FTId=VSP_027469 VAR_SEQ 252 309 Missing (in isoform 4 and isoform 6) /FTId=VSP_027470 VAR_SEQ 437 479 YVLILNVFPAPPKRSFFPVLTEWYIPLEKDERHQWIVLLSF QL -> VRKEEPGPWEG (in isoform 5) /FTId=VSP_027471 VAR_SEQ 437 479 YVLILNVFPAPPKRSFFPVLTEWYIPLEKDERHQWIVLLSF QL -> S (in isoform TGN46, isoform 4 and isoform 6). {ECO:0000303|PubMed:14702039, ECO:0000303|PubMed:15489334, ECO:0000303|PubMed:17974005, ECO:0000303|PubMed:8907712, ECO:0000303|PubMed:9422759, ECO:0000303|Ref.4} /FTId=VSP_004454 VAR_SEQ 437 479 YVLILNVFPAPPKRSFFPVLTEWYIPLEKDERHQWIVLLSF QL -> IFFPLSPNRMVYSSGKR (in isoform TGN48). /FTId=VSP_004455 VARIANT 10 10 L -> V (in dbSNP:rs1128140) /FTId=VAR_034724 VARIANT 86 86 A -> G (in dbSNP:rs1044962) /FTId=VAR_034725 VARIANT 91 91 Q -> L (in dbSNP:rs1044963) /FTId=VAR_034726 VARIANT 103 103 K -> Q (in dbSNP:rs1044964) /FTId=VAR_034727 VARIANT 105 105 Q -> P. /FTId=VAR_034728 VARIANT 259 259 R -> W (in dbSNP:rs4247303) {ECO:0000269|PubMed:14702039, ECO:0000269|PubMed:8907712, ECO:0000269|Ref.4, ECO:0000269|Ref.7} /FTId=VAR_034729 VARIANT 322 322 E -> G (in dbSNP:rs1044969) /FTId=VAR_034730 VARIANT 455 479 Missing /FTId=VAR_080191 MUTAGEN 430 430 Y->A: Loss of relocalization to the trans-Golgi CONFLICT 30 30 E -> D (in Ref. 8; AAH08461) CONFLICT 71 71 S -> G (in Ref. 4; BAD96549) CONFLICT 74 74 A -> P (in Ref. 4; BAD96783) CONFLICT 158 158 A -> P (in Ref. 1; AAB96906/AAB96907/ AAB96908/AAC39539/AAC39541/AAC39542) CONFLICT 386 386 F -> S (in Ref. 5; CAE45926) CONFLICT 453 454 FP -> LPQ (in Ref. 1; AAB96908) CONFLICT 454 454 P -> PQ (in Ref. 7; EAW99536/EAW99539) SEQUENCE 479 AA; 51019 MW; 65253DBCF3D7927B CRC64; MRFVVALVLL NVAAAGAVPL LATESVKQEE AGVRPSAGNV STHPSLSQRP GGSTKSHPEP QTPKDSPSKS SAEAQTPEDT PNKSGAEAKT QKDSSNKSGA EAKTQKGSTS KSGSEAQTTK DSTSKSHPEL QTPKDSTGKS GAEAQTPEDS PNRSGAEAKT QKDSPSKSGS EAQTTKDVPN KSGADGQTPK DGSSKSGAED QTPKDVPNKS GAEKQTPKDG SNKSGAEEQG PIDGPSKSGA EEQTSKDSPN KVVPEQPSRK DHSKPISNPS DNKELPKADT NQLADKGKLS PHAFKTESGE ETDLISPPQE EVKSSEPTED VEPKEAEDDD TGPEEGSPPK EEKEKMSGSA SSENREGTLS DSTGSEKDDL YPNGSGNGSA ESSHFFAYLV TAAILVAVLY IAHHNKRKII AFVLEGKRSK VTRRPKASDY QRLDQKYVLI LNVFPAPPKR SFFPVLTEWY IPLEKDERHQ WIVLLSFQL
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to, and receive a free "I Love Antibodies" mug.


TGOLN2 may be involved in regulating membrane traffic to and from trans-Golgi network.


Wu,C.,, Proteomics 7 (11), 1775-1785 (2007)
Honing,S.,, Mol. Cell 18 (5), 519-531 (2005)

Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at

$ 325.00
$ 109.00
Cat# AP8955b
Availability: In Stock
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions