Register or Login
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Peptides   >   Blocking Peptides   >   SPATA22 Antibody (N-term) Blocking peptide   

SPATA22 Antibody (N-term) Blocking peptide

Synthetic peptide

Product Information
Primary Accession Q8NHS9
Other Accession NP_001164167.1, NP_001164170.1, NP_115987.2, NP_001164168.1, NP_001164169.1, NP_001164166.1
Clone Names 100111177
Peptide ID 100111177
Additional Information
Other Names Spermatogenesis-associated protein 22, Testis development protein NYD-SP20, SPATA22
Format Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 1 mg/ml.
StorageMaintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.
PrecautionsThis product is for research use only. Not for use in diagnostic or therapeutic procedures.
Protein Information
Name SPATA22
Function Meiosis-specific protein required for homologous recombination in meiosis I.
Cellular Location Chromosome. Note=Localizes on meiotic chromosome axes. Accumulates on resected DNA. Localization is dependent on MEIOB (By similarity).
Tissue Location Highly expressed in adult testis. EMBL; AF367472; AAK53408.1; -; mRNA EMBL; AY032684; AAK51120.1; -; mRNA EMBL; AY035867; AAK61373.1; -; mRNA EMBL; AY035868; AAK61374.1; -; mRNA EMBL; AK301892; BAG63323.1; -; mRNA EMBL; AC025125; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; CH471108; EAW90508.1; -; Genomic_DNA EMBL; CH471108; EAW90509.1; -; Genomic_DNA EMBL; CH471108; EAW90510.1; -; Genomic_DNA EMBL; CH471108; EAW90511.1; -; Genomic_DNA EMBL; BC029483; AAH29483.1; -; mRNA CCDS; CCDS11027.1; -. [Q8NHS9-1] CCDS; CCDS54066.1; -. [Q8NHS9-2] CCDS; CCDS54067.1; -. [Q8NHS9-3] RefSeq; NP_001164166.1; NM_001170695.1. [Q8NHS9-1] RefSeq; NP_001164167.1; NM_001170696.1. [Q8NHS9-2] RefSeq; NP_001164168.1; NM_001170697.1. [Q8NHS9-1] RefSeq; NP_001164169.1; NM_001170698.1. [Q8NHS9-1] RefSeq; NP_001164170.1; NM_001170699.1. [Q8NHS9-3] RefSeq; NP_001308265.1; NM_001321336.1 RefSeq; NP_001308266.1; NM_001321337.1. [Q8NHS9-1] RefSeq; NP_115987.2; NM_032598.4. [Q8NHS9-1] UniGene; Hs.351068; - ProteinModelPortal; Q8NHS9; - BioGrid; 124205; 9 IntAct; Q8NHS9; 6 MINT; Q8NHS9; - STRING; 9606.ENSP00000380354; - iPTMnet; Q8NHS9; - PhosphoSitePlus; Q8NHS9; - BioMuta; SPATA22; - DMDM; 296452914; - EPD; Q8NHS9; - PaxDb; Q8NHS9; - PeptideAtlas; Q8NHS9; - PRIDE; Q8NHS9; - ProteomicsDB; 73750; - ProteomicsDB; 73751; -. [Q8NHS9-2] DNASU; 84690; - Ensembl; ENST00000268981; ENSP00000268981; ENSG00000141255. [Q8NHS9-3] Ensembl; ENST00000355380; ENSP00000347541; ENSG00000141255. [Q8NHS9-2] Ensembl; ENST00000397168; ENSP00000380354; ENSG00000141255. [Q8NHS9-1] Ensembl; ENST00000572969; ENSP00000460187; ENSG00000141255. [Q8NHS9-1] Ensembl; ENST00000573128; ENSP00000459580; ENSG00000141255. [Q8NHS9-1] Ensembl; ENST00000575375; ENSP00000459329; ENSG00000141255. [Q8NHS9-1] GeneID; 84690; - KEGG; hsa:84690; - UCSC; uc002fvm.5; human. [Q8NHS9-1] CTD; 84690; - DisGeNET; 84690; - EuPathDB; HostDB:ENSG00000141255.12; - GeneCards; SPATA22; - HGNC; HGNC:30705; SPATA22 MIM; 617673; gene neXtProt; NX_Q8NHS9; - OpenTargets; ENSG00000141255; - PharmGKB; PA142670887; - eggNOG; ENOG410IVC3; Eukaryota eggNOG; ENOG4111W26; LUCA GeneTree; ENSGT00390000018151; - HOGENOM; HOG000038032; - HOVERGEN; HBG093993; - InParanoid; Q8NHS9; - KO; K22421; - OMA; WEAMNPE; - OrthoDB; 938712at2759; - PhylomeDB; Q8NHS9; - TreeFam; TF332549; - ChiTaRS; SPATA22; human GenomeRNAi; 84690; - PRO; PR:Q8NHS9; - Proteomes; UP000005640; Chromosome 17 Bgee; ENSG00000141255; Expressed in 90 organ(s), highest expression level in testis ExpressionAtlas; Q8NHS9; baseline and differential Genevisible; Q8NHS9; HS GO; GO:0005694; C:chromosome; IEA:UniProtKB-SubCell GO; GO:0007276; P:gamete generation; IEA:InterPro GO; GO:0000711; P:meiotic DNA repair synthesis; IEA:InterPro GO; GO:0007129; P:synapsis; IEA:InterPro InterPro; IPR033536; Spata22 PANTHER; PTHR35258; PTHR35258; 1 1: Evidence at protein level; Alternative splicing; Chromosome; Complete proteome; Meiosis; Polymorphism; Reference proteome CHAIN 1 363 Spermatogenesis-associated protein 22 /FTId=PRO_0000251605 VAR_SEQ 15 57 Missing (in isoform 2) /FTId=VSP_020763 VAR_SEQ 268 363 AVLDSAVTPGPYYSKTFLMRDGKNTLPCVFYEIDRELPRLI RGRVHRCVGNYDQKKNIFQCVSVRPASVSEQKTFQAFVKIA DVEMQYYINVMNET -> GS (in isoform 3) /FTId=VSP_044858 VARIANT 112 112 R -> T (in dbSNP:rs2291604) /FTId=VAR_027693 VARIANT 148 148 V -> M (in dbSNP:rs1488690) /FTId=VAR_027694 VARIANT 155 155 Q -> R (in dbSNP:rs11556563) /FTId=VAR_027695 VARIANT 160 160 I -> T (in dbSNP:rs1488689) /FTId=VAR_027696 CONFLICT 6 6 N -> S (in Ref. 1; AAK51120/AAK53408/ AAK61373/AAK61374). CONFLICT 84 84 V -> A (in Ref. 1; AAK53408/AAK61373/ AAK61374). CONFLICT 106 106 Q -> R (in Ref. 2; BAG63323) SEQUENCE 363 AA; 41318 MW; 71E6C8E4BF2526B8 CRC64; MKRSLNENSA RSTAGCLPVP LFNQKKRNRQ PLTSNPLKDD SGISTPSDNY DFPPLPTDWA WEAVNPELAP VMKTVDTGQI PHSVSRPLRS QDSVFNSIQS NTGRSQGGWS YRDGNKNTSL KTWNKNDFKP QCKRTNLVAN DGKNSCPVSS GAQQQKQLRI PEPPNLSRNK ETELLRQTHS SKISGCTMRG LDKNSALQTL KPNFQQNQYK KQMLDDIPED NTLKETSLYQ LQFKEKASSL RIISAVIESM KYWREHAQKT VLLFEVLAVL DSAVTPGPYY SKTFLMRDGK NTLPCVFYEI DRELPRLIRG RVHRCVGNYD QKKNIFQCVS VRPASVSEQK TFQAFVKIAD VEMQYYINVM NET
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to, and receive a free "I Love Antibodies" mug.


Aston, K.I., et al. Hum. Reprod. 25(6):1383-1397(2010)Huang, X., et al. J. Androl. 26(2):189-196(2005)

Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at

$ 99.00
Cat# BP10423a
Availability: In Stock
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions