Register or Login
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Peptides   >   Blocking Peptides   >   CRIP3 Antibody (Center) Blocking Peptide   

CRIP3 Antibody (Center) Blocking Peptide

Synthetic peptide

Product Information
Primary Accession Q6Q6R5
Other Accession NP_996805.2
Clone Names 100111282
Peptide ID 100111282
Additional Information
Other Names Cysteine-rich protein 3, CRP-3, Chromosome 6 LIM domain only protein, h6LIMo, CRIP3, CRP3
Format Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 1 mg/ml.
StorageMaintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.
PrecautionsThis product is for research use only. Not for use in diagnostic or therapeutic procedures.
Protein Information
Name CRIP3
Synonyms CRP3
Cellular Location Cytoplasm.
Tissue Location Expressed in most tissues, but not in skeletal muscle. EMBL; AY555741; AAS66887.1; -; mRNA EMBL; AY555742; AAS66888.1; -; mRNA EMBL; AY555743; AAS66889.1; -; mRNA EMBL; AY555744; AAS66890.1; -; mRNA EMBL; AL583834; -; NOT_ANNOTATED_CDS; Genomic_DNA CCDS; CCDS4894.2; -. [Q6Q6R5-3] RefSeq; NP_996805.2; NM_206922.2. [Q6Q6R5-3] RefSeq; XP_005249160.1; XM_005249103.3. [Q6Q6R5-1] RefSeq; XP_011512911.1; XM_011514609.2. [Q6Q6R5-4] UniGene; Hs.653165; - ProteinModelPortal; Q6Q6R5; - SMR; Q6Q6R5; - IntAct; Q6Q6R5; 2 iPTMnet; Q6Q6R5; - PhosphoSitePlus; Q6Q6R5; - BioMuta; CRIP3; - DMDM; 92087061; - PaxDb; Q6Q6R5; - PeptideAtlas; Q6Q6R5; - PRIDE; Q6Q6R5; - ProteomicsDB; 67271; - ProteomicsDB; 67272; -. [Q6Q6R5-2] ProteomicsDB; 67273; -. [Q6Q6R5-3] ProteomicsDB; 67274; -. [Q6Q6R5-4] DNASU; 401262; - Ensembl; ENST00000274990; ENSP00000274990; ENSG00000146215. [Q6Q6R5-1] Ensembl; ENST00000372569; ENSP00000361650; ENSG00000146215. [Q6Q6R5-3] GeneID; 401262; - KEGG; hsa:401262; - UCSC; uc003ouu.2; human. [Q6Q6R5-1] CTD; 401262; - DisGeNET; 401262; - EuPathDB; HostDB:ENSG00000146215.13; - GeneCards; CRIP3; - HGNC; HGNC:17751; CRIP3 HPA; HPA036198; - neXtProt; NX_Q6Q6R5; - OpenTargets; ENSG00000146215; - PharmGKB; PA134929489; - eggNOG; ENOG410KDR9; Eukaryota eggNOG; ENOG4110HIQ; LUCA GeneTree; ENSGT00550000074548; - HOGENOM; HOG000111234; - HOVERGEN; HBG051143; - InParanoid; Q6Q6R5; - OMA; CEEPVYF; - OrthoDB; EOG091G11RX; - PhylomeDB; Q6Q6R5; - TreeFam; TF313758; - ChiTaRS; CRIP3; human GenomeRNAi; 401262; - PRO; PR:Q6Q6R5; - Proteomes; UP000005640; Chromosome 6 Bgee; ENSG00000146215; - CleanEx; HS_CRIP3; - ExpressionAtlas; Q6Q6R5; baseline and differential Genevisible; Q6Q6R5; HS GO; GO:0005737; C:cytoplasm; IEA:UniProtKB-SubCell GO; GO:0046872; F:metal ion binding; IEA:UniProtKB-KW InterPro; IPR001781; Znf_LIM Pfam; PF00412; LIM; 2 SMART; SM00132; LIM; 2 PROSITE; PS00478; LIM_DOMAIN_1; 2 PROSITE; PS50023; LIM_DOMAIN_2; 2 2: Evidence at transcript level; Alternative splicing; Complete proteome; Cytoplasm; LIM domain; Metal-binding; Reference proteome; Repeat; Zinc CHAIN 1 217 Cysteine-rich protein 3 /FTId=PRO_0000225638 DOMAIN 3 64 LIM zinc-binding 1. {ECO:0000255|PROSITE- ProRule:PRU00125} DOMAIN 122 183 LIM zinc-binding 2. {ECO:0000255|PROSITE- ProRule:PRU00125} VAR_SEQ 166 217 HDGVPYCHVPCYGYLFGPKGGQPHPRHWDGMYMPEVWHVHG LWVCVDNFPCG -> V (in isoform 4) /FTId=VSP_017391 VAR_SEQ 186 217 GQPHPRHWDGMYMPEVWHVHGLWVCVDNFPCG -> VNIGD VGCYIYDPVKIKFK (in isoform 3) /FTId=VSP_017393 VAR_SEQ 205 217 HGLWVCVDNFPCG -> V (in isoform 2) /FTId=VSP_017392 CONFLICT 141 141 G -> S (in Ref. 1; AAS66887/AAS66888/ AAS66889/AAS66890). CONFLICT 148 148 C -> R (in Ref. 1; AAS66887/AAS66888/ AAS66889/AAS66890). SEQUENCE 217 AA; 24088 MW; B8FC618E29AE244F CRC64; MSWTCPRCQQ PVFFAEKVSS LGKNWHRFCL KCERCHSILS PGGHAEHNGR PYCHKPCYGA LFGPRGVNIG GVGSYLYNPP TPSPGCTTPL SPSSFSPPRP RTGLPQGKKS PPHMKTFTGE TSLCPGCGEP VYFAEKVMSL GRNWHRPCLR CQRCHKTLTA GSHAEHDGVP YCHVPCYGYL FGPKGGQPHP RHWDGMYMPE VWHVHGLWVC VDNFPCG
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to, and receive a free "I Love Antibodies" mug.


Casrouge, A., et al. Microbes Infect. 6(12):1063-1072(2004)Mungall, A.J., et al. Nature 425(6960):805-811(2003)

Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at

$ 99.00
Cat# BP10618c
Availability: In Stock
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions