Register or Login
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Peptides   >   Blocking Peptides   >   KCNRG Antibody (C-term) Blocking peptide   

KCNRG Antibody (C-term) Blocking peptide

Synthetic peptide

Product Information
Primary Accession Q8N5I3
Clone Names 101008269
Peptide ID 101008269
Additional Information
Other Names Potassium channel regulatory protein, Potassium channel regulator, Protein CLLD4, KCNRG, CLLD4
Format Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 1 mg/ml.
StorageMaintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.
PrecautionsThis product is for research use only. Not for use in diagnostic or therapeutic procedures.
Protein Information
Synonyms CLLD4
Function Inhibits potassium fluxes in cells. May regulate Kv1 family channel proteins by retaining a fraction of channels in endomembranes.
Cellular Location Endoplasmic reticulum
Tissue Location Ubiquitous in normal tissues and expressed in some tumor tissues. EMBL; AY129653; AAN06090.1; -; mRNA EMBL; AY129654; AAN06091.1; -; mRNA EMBL; AY169387; AAO11777.1; -; mRNA EMBL; AY169388; AAO11778.1; -; mRNA EMBL; AY190921; AAO27464.1; -; mRNA EMBL; AY190922; AAO27465.1; -; mRNA EMBL; AL137060; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; CH471075; EAX08849.1; -; Genomic_DNA EMBL; CH471075; EAX08850.1; -; Genomic_DNA EMBL; BC020887; AAH20887.1; -; mRNA EMBL; BC032343; AAH32343.1; -; mRNA CCDS; CCDS41889.1; -. [Q8N5I3-2] CCDS; CCDS9424.1; -. [Q8N5I3-1] RefSeq; NP_775876.1; NM_173605.1. [Q8N5I3-1] RefSeq; NP_955751.1; NM_199464.2. [Q8N5I3-2] UniGene; Hs.660161; - ProteinModelPortal; Q8N5I3; - SMR; Q8N5I3; - BioGrid; 129592; 8 IntAct; Q8N5I3; 9 MINT; Q8N5I3; - STRING; 9606.ENSP00000324191; - iPTMnet; Q8N5I3; - PhosphoSitePlus; Q8N5I3; - BioMuta; KCNRG; - DMDM; 74729005; - PaxDb; Q8N5I3; - PeptideAtlas; Q8N5I3; - PRIDE; Q8N5I3; - ProteomicsDB; 72060; - ProteomicsDB; 72061; -. [Q8N5I3-2] DNASU; 10206; - DNASU; 283518; - Ensembl; ENST00000312942; ENSP00000324191; ENSG00000198553. [Q8N5I3-1] Ensembl; ENST00000360473; ENSP00000353661; ENSG00000198553. [Q8N5I3-2] GeneID; 283518; - KEGG; hsa:283518; - UCSC; uc001vdt.4; human. [Q8N5I3-1] CTD; 283518; - DisGeNET; 283518; - EuPathDB; HostDB:ENSG00000198553.8; - GeneCards; KCNRG; - HGNC; HGNC:18893; KCNRG HPA; HPA001027; - MIM; 607947; gene neXtProt; NX_Q8N5I3; - OpenTargets; ENSG00000198553; - PharmGKB; PA134924183; - eggNOG; KOG2723; Eukaryota eggNOG; ENOG410Z155; LUCA GeneTree; ENSGT00760000119013; - HOGENOM; HOG000230898; - HOVERGEN; HBG079982; - InParanoid; Q8N5I3; - OMA; RYVSIKP; - OrthoDB; EOG091G0EJ2; - PhylomeDB; Q8N5I3; - TreeFam; TF315332; - GeneWiki; KCNRG; - GenomeRNAi; 283518; - PRO; PR:Q8N5I3; - Proteomes; UP000005640; Chromosome 13 Bgee; ENSG00000198553; - CleanEx; HS_KCNRG; - Genevisible; Q8N5I3; HS GO; GO:0005783; C:endoplasmic reticulum; IDA:UniProtKB GO; GO:0042802; F:identical protein binding; IPI:IntAct GO; GO:1902260; P:negative regulation of delayed rectifier potassium channel activity; IDA:UniProtKB GO; GO:0051260; P:protein homooligomerization; IEA:InterPro InterPro; IPR000210; BTB/POZ_dom InterPro; IPR011333; SKP1/BTB/POZ_sf InterPro; IPR003131; T1-type_BTB Pfam; PF02214; BTB_2; 1 SMART; SM00225; BTB; 1 SUPFAM; SSF54695; SSF54695; 1 1: Evidence at protein level; Alternative splicing; Complete proteome; Endoplasmic reticulum; Reference proteome CHAIN 1 272 Potassium channel regulatory protein /FTId=PRO_0000238945 DOMAIN 5 106 BTB VAR_SEQ 194 229 YVSIKPDNRKLANGTNVLGLLIDTLLKEGFHLVSTR -> L VCNGVISAHHNLRLWGSSDSPASASRVAGITGMFL (in isoform 2). {ECO:0000303|PubMed:12650944, ECO:0000303|PubMed:15489334, ECO:0000303|Ref.2} /FTId=VSP_019018 VAR_SEQ 230 272 Missing (in isoform 2) {ECO:0000303|PubMed:12650944, ECO:0000303|PubMed:15489334, ECO:0000303|Ref.2} /FTId=VSP_019021 SEQUENCE 272 AA; 31048 MW; 5018F55980F0BBA5 CRC64; MSSQELVTLN VGGKIFTTRF STIKQFPASR LARMLDGRDQ EFKMVGGQIF VDRDGDLFSF ILDFLRTHQL LLPTEFSDYL RLQREALFYE LRSLVDLLNP YLLQPRPALV EVHFLSRNTQ AFFRVFGSCS KTIEMLTGRI TVFTEQPSAP TWNGNFFPPQ MTLLPLPPQR PSYHDLVFQC GSDSTTDNQT GVRYVSIKPD NRKLANGTNV LGLLIDTLLK EGFHLVSTRT VSSEDKTECY SFERIKSPEV LITNETPKPE TIIIPEQSQI KK
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to, and receive a free "I Love Antibodies" mug.


The protein encoded by this gene is a regulatory subunitof the AMP-activated protein kinase (AMPK). AMPK is a heterotrimerconsisting of an alpha catalytic subunit, and non-catalytic betaand gamma subunits. AMPK is an important energy-sensing enzyme thatmonitors cellular energy status. In response to cellular metabolicstresses, AMPK is activated, and thus phosphorylates andinactivates acetyl-CoA carboxylase (ACC) and beta-hydroxybeta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved inregulating de novo biosynthesis of fatty acid and cholesterol. Thissubunit is one of the gamma regulatory subunits of AMPK.Alternatively spliced transcript variants encoding distinctisoforms have been observed.


Jablonski, K.A., et al. Diabetes 59(10):2672-2681(2010)Bailey, S.D., et al. Diabetes Care 33(10):2250-2253(2010)Jassim, G., et al. Pharmacopsychiatry (2010) In press :Ruano, G., et al. Pharmacogenomics 11(7):959-971(2010)McGeachie, M., et al. Circulation 120(24):2448-2454(2009)

Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at

$ 80.00
Cat# BP11851b
Availability: In Stock
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions