Register or Login
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Peptides   >   Blocking Peptides   >   PABPN1L Antibody (Center) Blocking peptide   

PABPN1L Antibody (Center) Blocking peptide

Synthetic peptide

Product Information
Primary Accession A6NDY0
Other Accession NP_001073956
Clone Names 100309265
Peptide ID 100309265
Additional Information
Other Names Embryonic polyadenylate-binding protein 2, Embryonic poly(A)-binding protein 2, ePABP-2, ePABP2, Embryonic poly(A)-binding protein type II, Poly(A)-binding protein nuclear-like 1, PABPN1L, EPABP2, PABPNL1
Format Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 1 mg/ml.
StorageMaintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.
PrecautionsThis product is for research use only. Not for use in diagnostic or therapeutic procedures.
Protein Information
Synonyms EPABP2, PABPNL1
Function Binds the poly(A) tail of mRNA.
Cellular Location Cytoplasm.
Tissue Location Expressed in various adult tissues. EMBL; AC092384; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; BC130001; AAI30002.1; -; mRNA EMBL; BC130002; AAI30003.1; -; mRNA CCDS; CCDS45547.2; -. [A6NDY0-1] CCDS; CCDS73925.1; -. [A6NDY0-2] RefSeq; NP_001073956.2; NM_001080487.2. [A6NDY0-1] RefSeq; NP_001281257.1; NM_001294328.1. [A6NDY0-2] RefSeq; XP_016878719.1; XM_017023230.1. [A6NDY0-1] UniGene; Hs.730522; - ProteinModelPortal; A6NDY0; - SMR; A6NDY0; - STRING; 9606.ENSP00000408598; - iPTMnet; A6NDY0; - PhosphoSitePlus; A6NDY0; - BioMuta; PABPN1L; - MaxQB; A6NDY0; - PaxDb; A6NDY0; - PRIDE; A6NDY0; - ProteomicsDB; 940; - ProteomicsDB; 941; -. [A6NDY0-2] ProteomicsDB; 942; -. [A6NDY0-3] ProteomicsDB; 943; -. [A6NDY0-4] TopDownProteomics; A6NDY0-3; -. [A6NDY0-3] DNASU; 390748; - Ensembl; ENST00000411789; ENSP00000405259; ENSG00000205022. [A6NDY0-2] Ensembl; ENST00000419291; ENSP00000408598; ENSG00000205022. [A6NDY0-1] GeneID; 390748; - KEGG; hsa:390748; - UCSC; uc002fmi.4; human. [A6NDY0-1] CTD; 390748; - EuPathDB; HostDB:ENSG00000205022.9; - GeneCards; PABPN1L; - H-InvDB; HIX0059621; - HGNC; HGNC:37237; PABPN1L HPA; HPA043415; - neXtProt; NX_A6NDY0; - OpenTargets; ENSG00000205022; - eggNOG; KOG4209; Eukaryota eggNOG; ENOG4111PFV; LUCA GeneTree; ENSGT00390000001517; - HOGENOM; HOG000208465; - HOVERGEN; HBG107480; - InParanoid; A6NDY0; - KO; K14396; - OMA; IKLKLWA; - OrthoDB; EOG091G0PAK; - PhylomeDB; A6NDY0; - TreeFam; TF105907; - GenomeRNAi; 390748; - PRO; PR:A6NDY0; - Proteomes; UP000005640; Chromosome 16 Bgee; ENSG00000205022; - ExpressionAtlas; A6NDY0; baseline and differential GO; GO:0005737; C:cytoplasm; IEA:UniProtKB-SubCell GO; GO:0003723; F:RNA binding; IEA:UniProtKB-KW Gene3D;; -; 1 InterPro; IPR012677; Nucleotide-bd_a/b_plait_sf InterPro; IPR035979; RBD_domain_sf InterPro; IPR000504; RRM_dom Pfam; PF00076; RRM_1; 1 SMART; SM00360; RRM; 1 SUPFAM; SSF54928; SSF54928; 1 PROSITE; PS50102; RRM; 1 2: Evidence at transcript level; Alternative splicing; Complete proteome; Cytoplasm; Reference proteome; RNA-binding CHAIN 1 278 Embryonic polyadenylate-binding protein 2 /FTId=PRO_0000349172 DOMAIN 147 224 RRM. {ECO:0000255|PROSITE- ProRule:PRU00176} VAR_SEQ 154 154 V -> LCLHRVCHQGLRAGRRGAGPEPLPGPGHQGAAEKNQ LPWDQLHRPRGPSRTPRLQGGTLPPQRPPGQAPAQTTRAEP GPWKILTMVFTVLKGRPDFERGAGAWIRSKPLVLHPG (in isoform 3) /FTId=VSP_035211 VAR_SEQ 155 278 Missing (in isoform 3) /FTId=VSP_035212 VAR_SEQ 190 190 Y -> CCRKEPTSLGSAPQTAGAFEDTQAPGGHPSPTAASR AGPGSDHKGRTGPVENSHHGFHRIKGKTRF (in isoform 2) /FTId=VSP_035213 VAR_SEQ 191 278 Missing (in isoform 2) /FTId=VSP_035214 VAR_SEQ 267 278 ARGKFSPWFSPY -> TPAALTPLWARPLPWVVVSHVIK (in isoform 4). /FTId=VSP_040501 SEQUENCE 278 AA; 30386 MW; 4662DAB7022CACD5 CRC64; MWPFPSRSLF PPPTQAWLQT VSSDPEAQGW GAWNETKEIL GPEGGEGKEE KEEEEDAEED QDGDAGFLLS LLEQENLAEC PLPDQELEAI KMKVCAMEQA EGTPRPPGVQ QQAEEEEGTA AGQLLSPETV GCPLSGTPEE KVEADHRSVY VGNVDYGGSA EELEAHFSRC GEVHRVTILC DKFSGHPKGY AYIEFATKGS VQAAVELDQS LFRGRVIKVL PKRTNFPGIS STDRGGLRGH PGSRGAPFPH SGLQGRPRLR PQGQNRARGK FSPWFSPY
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to, and receive a free "I Love Antibodies" mug.


The function of this protein remains unknown.

Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at

$ 80.00
Cat# BP11914c
Availability: In Stock
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions