Register or Login
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Peptides   >   Blocking Peptides   >   RNF38 Antibody (N-term) Blocking peptide   

RNF38 Antibody (N-term) Blocking peptide

Synthetic peptide

Product Information
Primary Accession Q9H0F5
Clone Names 100324250
Peptide ID 100324250
Additional Information
Other Names E3 ubiquitin-protein ligase RNF38, 632-, RING finger protein 38, RNF38
Format Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 1 mg/ml.
StorageMaintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.
PrecautionsThis product is for research use only. Not for use in diagnostic or therapeutic procedures.
Protein Information
Name RNF38
Function Acts as an E3 ubiquitin-protein ligase able to ubiquitinate p53/TP53 which promotes its relocalization to discrete foci associated with PML nuclear bodies. Exhibits preference for UBE2D2 as a E2 enzyme.
Cellular Location Nucleus.
Tissue Location Widely expressed with highest levels in testis. EMBL; AF394047; AAM73697.1; -; mRNA EMBL; AL136817; CAB66751.3; -; mRNA EMBL; AK024996; BAB15050.1; -; mRNA EMBL; AK093480; BAG52726.1; -; mRNA EMBL; AL161792; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; AL354935; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; CH471071; EAW58305.1; -; Genomic_DNA EMBL; BC033786; AAH33786.2; -; mRNA CCDS; CCDS6603.1; -. [Q9H0F5-1] CCDS; CCDS6604.1; -. [Q9H0F5-2] RefSeq; NP_073618.3; NM_022781.4. [Q9H0F5-1] RefSeq; NP_919309.1; NM_194328.2. [Q9H0F5-3] RefSeq; NP_919310.1; NM_194329.2. [Q9H0F5-2] RefSeq; NP_919311.1; NM_194330.2. [Q9H0F5-3] RefSeq; NP_919313.1; NM_194332.2. [Q9H0F5-3] RefSeq; XP_005251423.1; XM_005251366.3. [Q9H0F5-3] RefSeq; XP_005251424.1; XM_005251367.3. [Q9H0F5-3] RefSeq; XP_005251425.1; XM_005251368.3. [Q9H0F5-3] RefSeq; XP_006716784.1; XM_006716721.3. [Q9H0F5-3] RefSeq; XP_011516014.1; XM_011517712.2. [Q9H0F5-3] RefSeq; XP_011516015.1; XM_011517713.2. [Q9H0F5-3] RefSeq; XP_016869784.1; XM_017014295.1. [Q9H0F5-3] UniGene; Hs.333503; - PDB; 1X4J; NMR; -; A=445-506 PDB; 4V3K; X-ray; 2.04 A; C/F=439-515 PDB; 4V3L; X-ray; 1.53 A; C=439-515 PDBsum; 1X4J; - PDBsum; 4V3K; - PDBsum; 4V3L; - ProteinModelPortal; Q9H0F5; - SMR; Q9H0F5; - BioGrid; 127416; 17 IntAct; Q9H0F5; 20 STRING; 9606.ENSP00000259605; - iPTMnet; Q9H0F5; - PhosphoSitePlus; Q9H0F5; - BioMuta; RNF38; - DMDM; 56749664; - PaxDb; Q9H0F5; - PeptideAtlas; Q9H0F5; - PRIDE; Q9H0F5; - ProteomicsDB; 80269; - ProteomicsDB; 80270; -. [Q9H0F5-2] ProteomicsDB; 80271; -. [Q9H0F5-3] DNASU; 152006; - Ensembl; ENST00000259605; ENSP00000259605; ENSG00000137075. [Q9H0F5-1] Ensembl; ENST00000350199; ENSP00000343947; ENSG00000137075. [Q9H0F5-3] Ensembl; ENST00000353739; ENSP00000335239; ENSG00000137075. [Q9H0F5-2] Ensembl; ENST00000357058; ENSP00000349566; ENSG00000137075. [Q9H0F5-3] Ensembl; ENST00000377877; ENSP00000367109; ENSG00000137075. [Q9H0F5-4] Ensembl; ENST00000377885; ENSP00000367117; ENSG00000137075. [Q9H0F5-3] Ensembl; ENST00000611646; ENSP00000483536; ENSG00000137075. [Q9H0F5-4] GeneID; 152006; - KEGG; hsa:152006; - UCSC; uc003zzh.5; human. [Q9H0F5-1] CTD; 152006; - EuPathDB; HostDB:ENSG00000137075.17; - GeneCards; RNF38; - HGNC; HGNC:18052; RNF38 HPA; HPA015853; - MIM; 612488; gene neXtProt; NX_Q9H0F5; - OpenTargets; ENSG00000137075; - PharmGKB; PA34438; - eggNOG; KOG0800; Eukaryota eggNOG; ENOG41121N2; LUCA GeneTree; ENSGT00730000110459; - HOGENOM; HOG000231638; - HOVERGEN; HBG059283; - InParanoid; Q9H0F5; - KO; K19041; - OMA; NQHHFSG; - OrthoDB; EOG091G09VT; - PhylomeDB; Q9H0F5; - TreeFam; TF325756; - UniPathway; UPA00143; - ChiTaRS; RNF38; human EvolutionaryTrace; Q9H0F5; - GeneWiki; RNF38; - GenomeRNAi; 152006; - PRO; PR:Q9H0F5; - Proteomes; UP000005640; Chromosome 9 Bgee; ENSG00000137075; - CleanEx; HS_RNF38; - Genevisible; Q9H0F5; HS GO; GO:0005654; C:nucleoplasm; IDA:HPA GO; GO:0005634; C:nucleus; IDA:FlyBase GO; GO:0036126; C:sperm flagellum; IEA:Ensembl GO; GO:0046872; F:metal ion binding; IEA:UniProtKB-KW GO; GO:0061630; F:ubiquitin protein ligase activity; IBA:GO_Central GO; GO:0004842; F:ubiquitin-protein transferase activity; IDA:FlyBase GO; GO:0008584; P:male gonad development; IEA:Ensembl GO; GO:0043161; P:proteasome-mediated ubiquitin-dependent protein catabolic process; IBA:GO_Central GO; GO:0016567; P:protein ubiquitination; IDA:FlyBase Gene3D;; -; 1 InterPro; IPR001841; Znf_RING InterPro; IPR013083; Znf_RING/FYVE/PHD Pfam; PF13639; zf-RING_2; 1 SMART; SM00184; RING; 1 PROSITE; PS50089; ZF_RING_2; 1 1: Evidence at protein level; 3D-structure; Alternative splicing; Complete proteome; Metal-binding; Nucleus; Polymorphism; Reference proteome; Transferase; Ubl conjugation pathway; Zinc; Zinc-finger CHAIN 1 515 E3 ubiquitin-protein ligase RNF38 /FTId=PRO_0000056078 ZN_FING 463 504 RING-type. {ECO:0000255|PROSITE- ProRule:PRU00175} MOTIF 57 71 Bipartite nuclear localization signal 1 MOTIF 115 131 Bipartite nuclear localization signal 2 COMPBIAS 239 404 Pro-rich VAR_SEQ 1 183 Missing (in isoform 5) /FTId=VSP_053845 VAR_SEQ 1 83 Missing (in isoform 3) /FTId=VSP_037337 VAR_SEQ 1 44 MACKISPGANSASLPGHPNKVICERVRLQSLFPLLPSDQNT TVQ -> MQHTCTQQKKVTYKHIARFSPRNRLCQADAVFNN NLAGFQLQSP (in isoform 4) /FTId=VSP_053846 VAR_SEQ 5 54 Missing (in isoform 2) /FTId=VSP_012243 VAR_SEQ 45 120 Missing (in isoform 4) /FTId=VSP_053847 VARIANT 206 206 A -> T (in dbSNP:rs183475137) /FTId=VAR_055400 CONFLICT 308 308 I -> K (in Ref. 2; CAB66751) CONFLICT 421 421 E -> G (in Ref. 3; BAG52726) HELIX 441 445 {ECO:0000244|PDB:4V3K} STRAND 448 450 {ECO:0000244|PDB:4V3L} STRAND 453 455 {ECO:0000244|PDB:1X4J} STRAND 457 459 {ECO:0000244|PDB:4V3L} TURN 464 467 {ECO:0000244|PDB:4V3L} STRAND 475 478 {ECO:0000244|PDB:4V3L} TURN 480 482 {ECO:0000244|PDB:1X4J} STRAND 484 486 {ECO:0000244|PDB:4V3L} HELIX 487 496 {ECO:0000244|PDB:4V3L} TURN 501 503 {ECO:0000244|PDB:4V3L} SEQUENCE 515 AA; 57595 MW; ABFE9486CA732AFA CRC64; MACKISPGAN SASLPGHPNK VICERVRLQS LFPLLPSDQN TTVQEDAHFK AFFQSEDSPS PKRQRLSHSV FDYTSASPAP SPPMRPWEMT SNRQPPSVRP SQHHFSGERC NTPARNRRSP PVRRQRGRRD RLSRHNSISQ DENYHHLPYA QQQAIEEPRA FHPPNVSPRL LHPAAHPPQQ NAVMVDIHDQ LHQGTVPVSY TVTTVAPHGI PLCTGQHIPA CSTQQVPGCS VVFSGQHLPV CSVPPPMLQA CSVQHLPVPY AAFPPLISSD PFLIHPPHLS PHHPPHLPPP GQFVPFQTQQ SRSPLQRIEN EVELLGEHLP VGGFTYPPSA HPPTLPPSAP LQFLTHDPLH QEVSFGVPYP PFMPRRLTGR SRYRSQQPIP PPPYHPSLLP YVLSMLPVPP AVGPTFSFEL DVEDGEVENY EALLNLAERL GEAKPRGLTK ADIEQLPSYR FNPNNHQSEQ TLCVVCMCDF ESRQLLRVLP CNHEFHAKCV DKWLKANRTC PICRADASEV HRDSE
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to, and receive a free "I Love Antibodies" mug.


This gene encodes a protein with a coiled-coil motif and aRING-H2 motif (C3H2C2) at its carboxy-terminus. The RING motif is azinc-binding domain found in a large set of proteins playing rolesin diverse cellular processes including oncogenesis, development,signal transduction, and apoptosis. Multiple transcript variantsencoding different isoforms have been found for this gene.


Humphray, S.J., et al. Nature 429(6990):369-374(2004)Eisenberg, I., et al. Biochem. Biophys. Res. Commun. 294(5):1169-1176(2002)

Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at

$ 99.00
Cat# BP12816a
Availability: In Stock
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions