Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Immunology   >   Anti-CD89 Antibody   

Anti-CD89 Antibody

     
  • WB - Anti-CD89 Antibody ABO10866
    Anti-CD89 antibody, ABO10866, Western blottingLane 1: A549 Cell LysateLane 2: U87 Cell LysateLane 3: RAJI Cell LysateLane 4: JURKAT Cell Lysate
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
WB
Primary Accession P24071
Host Rabbit
Reactivity Human
Clonality Polyclonal
Format Lyophilized
Description Rabbit IgG polyclonal antibody for Immunoglobulin alpha Fc receptor(FCAR) detection. Tested with WB in Human.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Additional Information
Other Names Immunoglobulin alpha Fc receptor, IgA Fc receptor, CD89, FCAR, CD89
Calculated MW 32265 MW KDa
Application Details Western blot, 0.1-0.5 µg/ml, Human
Subcellular Localization Isoform A.1: Cell membrane; Single-pass type I membrane protein.
Tissue Specificity Isoform A.1, isoform A.2 and isoform A.3 are differentially expressed between blood and mucosal myeloid cells. Isoform A.1, isoform A.2 and isoform A.3 are expressed in monocytes. Isoform A.1 and isoform A.2 are expressed in alveolar macrophages; however only one isoform is expressed at alveolar macrophages surfaces. .
Protein Name Immunoglobulin alpha Fc receptor(IgA Fc receptor)
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg Thimerosal, 0.05mg NaN3.
Immunogen A synthetic peptide corresponding to a sequence in the middle of human CD89(84-101aa EFVIDHMDANKAGRYQCQ).
Purification Immunogen affinity purified.
Cross Reactivity No cross reactivity with other proteins
Storage At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Information
Name FCAR
Synonyms CD89
Function Binds to the Fc region of immunoglobulins alpha. Mediates several functions including cytokine production.
Cellular Location Isoform A.1: Cell membrane; Single-pass type I membrane protein Isoform A.3: Cell membrane; Single-pass type I membrane protein Isoform B-delta-S2: Secreted.
Tissue Location Isoform A.1, isoform A.2 and isoform A.3 are differentially expressed between blood and mucosal myeloid cells Isoform A.1, isoform A.2 and isoform A.3 are expressed in monocytes. Isoform A.1 and isoform A.2 are expressed in alveolar macrophages; however only one isoform is expressed at alveolar macrophages surfaces. EMBL; X54150; CAA38089.1; -; mRNA EMBL; X87767; CAA61039.1; -; Genomic_DNA EMBL; X87768; CAA61039.1; JOINED; Genomic_DNA EMBL; X87769; CAA61039.1; JOINED; Genomic_DNA EMBL; X87766; CAA61039.1; JOINED; Genomic_DNA EMBL; X87765; CAA61039.1; JOINED; Genomic_DNA EMBL; U43774; AAC50639.1; -; mRNA EMBL; U43677; AAC50595.1; -; mRNA EMBL; U56236; AAB00566.1; -; mRNA EMBL; U56237; AAB00567.1; -; mRNA EMBL; S82919; AAD14421.1; -; mRNA EMBL; D87853; BAA13471.1; -; mRNA EMBL; D87854; BAA13472.1; -; mRNA EMBL; D87855; BAA13473.1; -; mRNA EMBL; D87856; BAA13474.1; -; mRNA EMBL; D87857; BAA13475.1; -; mRNA EMBL; D87859; BAA13477.1; -; mRNA EMBL; D87861; BAA13479.1; -; mRNA EMBL; D87862; BAA13480.1; -; mRNA EMBL; DQ075334; AAZ76577.1; -; mRNA EMBL; DQ075335; AAZ76578.1; -; mRNA EMBL; DQ075336; AAZ76579.1; -; mRNA EMBL; DQ075337; AAZ76580.1; -; mRNA EMBL; DQ075338; AAZ76581.1; -; mRNA EMBL; DQ075339; AAZ76582.1; -; mRNA EMBL; AC011501; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; BC027953; AAH27953.1; -; mRNA CCDS; CCDS12907.1; -. [P24071-1] CCDS; CCDS12908.1; -. [P24071-3] CCDS; CCDS12909.1; -. [P24071-10] CCDS; CCDS12910.1; -. [P24071-7] CCDS; CCDS42622.1; -. [P24071-2] CCDS; CCDS42623.1; -. [P24071-11] CCDS; CCDS42624.1; -. [P24071-9] CCDS; CCDS42625.1; -. [P24071-8] PIR; G02630; G02630 PIR; JH0332; JH0332 RefSeq; NP_001991.1; NM_002000.3. [P24071-1] RefSeq; NP_579803.1; NM_133269.3. [P24071-2] RefSeq; NP_579805.1; NM_133271.3. [P24071-3] RefSeq; NP_579806.1; NM_133272.3. [P24071-10] RefSeq; NP_579807.1; NM_133273.3. [P24071-9] RefSeq; NP_579808.1; NM_133274.3. [P24071-8] RefSeq; NP_579811.1; NM_133277.3. [P24071-7] RefSeq; NP_579812.1; NM_133278.3. [P24071-11] UniGene; Hs.659872; - PDB; 1OVZ; X-ray; 3.00 A; A/B=22-216 PDB; 1OW0; X-ray; 3.10 A; C/D=22-216 PDB; 1UCT; X-ray; 2.10 A; A=21-229 PDBsum; 1OVZ; - PDBsum; 1OW0; - PDBsum; 1UCT; - DisProt; DP00311; - ProteinModelPortal; P24071; - SMR; P24071; - BioGrid; 108498; 5 IntAct; P24071; 3 STRING; 9606.ENSP00000347714; - GuidetoPHARMACOLOGY; 2991; - MEROPS; I43.951; - iPTMnet; P24071; - PhosphoSitePlus; P24071; - BioMuta; FCAR; - DMDM; 119860; - PaxDb; P24071; - PeptideAtlas; P24071; - PRIDE; P24071; - ProteomicsDB; 54181; - ProteomicsDB; 54182; -. [P24071-10] ProteomicsDB; 54183; -. [P24071-11] ProteomicsDB; 54184; -. [P24071-2] ProteomicsDB; 54185; -. [P24071-3] ProteomicsDB; 54186; -. [P24071-4] ProteomicsDB; 54187; -. [P24071-5] ProteomicsDB; 54188; -. [P24071-6] ProteomicsDB; 54189; -. [P24071-7] ProteomicsDB; 54190; -. [P24071-8] ProteomicsDB; 54191; -. [P24071-9] DNASU; 2204; - Ensembl; ENST00000345937; ENSP00000338257; ENSG00000186431. [P24071-3] Ensembl; ENST00000353758; ENSP00000338058; ENSG00000186431. [P24071-7] Ensembl; ENST00000355524; ENSP00000347714; ENSG00000186431. [P24071-1] Ensembl; ENST00000359272; ENSP00000352218; ENSG00000186431. [P24071-10] Ensembl; ENST00000391723; ENSP00000375603; ENSG00000186431. [P24071-8] Ensembl; ENST00000391724; ENSP00000375604; ENSG00000186431. [P24071-11] Ensembl; ENST00000391725; ENSP00000375605; ENSG00000186431. [P24071-2] Ensembl; ENST00000391726; ENSP00000375606; ENSG00000186431. [P24071-9] Ensembl; ENST00000469767; ENSP00000473814; ENSG00000186431. [P24071-4] Ensembl; ENST00000488066; ENSP00000474512; ENSG00000186431. [P24071-5] Ensembl; ENST00000610340; ENSP00000477610; ENSG00000275136. [P24071-8] Ensembl; ENST00000610397; ENSP00000480965; ENSG00000275269. [P24071-3] Ensembl; ENST00000610786; ENSP00000483121; ENSG00000276858. [P24071-8] Ensembl; ENST00000611018; ENSP00000484483; ENSG00000275970. [P24071-11] Ensembl; ENST00000611130; ENSP00000484917; ENSG00000273738. [P24071-11] Ensembl; ENST00000611871; ENSP00000482976; ENSG00000273738. [P24071-10] Ensembl; ENST00000611943; ENSP00000482273; ENSG00000275564. [P24071-2] Ensembl; ENST00000612150; ENSP00000478233; ENSG00000275136. [P24071-3] Ensembl; ENST00000612159; ENSP00000484662; ENSG00000276985. [P24071-9] Ensembl; ENST00000612505; ENSP00000479792; ENSG00000276985. [P24071-8] Ensembl; ENST00000612803; ENSP00000478454; ENSG00000275970. [P24071-8] Ensembl; ENST00000612815; ENSP00000483503; ENSG00000275269. [P24071-8] Ensembl; ENST00000612918; ENSP00000482056; ENSG00000274580. [P24071-3] Ensembl; ENST00000613199; ENSP00000478465; ENSG00000276858. [P24071-1] Ensembl; ENST00000613201; ENSP00000482108; ENSG00000274580. [P24071-4] Ensembl; ENST00000613298; ENSP00000482451; ENSG00000275269. [P24071-9] Ensembl; ENST00000613318; ENSP00000481560; ENSG00000273738. [P24071-4] Ensembl; ENST00000613663; ENSP00000483437; ENSG00000275564. [P24071-4] Ensembl; ENST00000613685; ENSP00000481230; ENSG00000275564. [P24071-11] Ensembl; ENST00000614226; ENSP00000483099; ENSG00000276985. [P24071-1] Ensembl; ENST00000614298; ENSP00000483472; ENSG00000275970. [P24071-9] Ensembl; ENST00000614433; ENSP00000480748; ENSG00000276985. [P24071-2] Ensembl; ENST00000614689; ENSP00000480013; ENSG00000273738. [P24071-5] Ensembl; ENST00000614893; ENSP00000477966; ENSG00000273738. [P24071-2] Ensembl; ENST00000614917; ENSP00000479831; ENSG00000275970. [P24071-2] Ensembl; ENST00000614954; ENSP00000479924; ENSG00000276858. [P24071-9] Ensembl; ENST00000615040; ENSP00000477656; ENSG00000276858. [P24071-10] Ensembl; ENST00000615110; ENSP00000484276; ENSG00000274580. [P24071-2] Ensembl; ENST00000615361; ENSP00000482741; ENSG00000273738. [P24071-9] Ensembl; ENST00000615703; ENSP00000484868; ENSG00000275136. [P24071-4] Ensembl; ENST00000615719; ENSP00000482518; ENSG00000275136. [P24071-7] Ensembl; ENST00000615800; ENSP00000483841; ENSG00000276985. [P24071-4] Ensembl; ENST00000615829; ENSP00000482623; ENSG00000274580. [P24071-1] Ensembl; ENST00000615937; ENSP00000478075; ENSG00000274580. [P24071-11] Ensembl; ENST00000616340; ENSP00000481676; ENSG00000275269. [P24071-10] Ensembl; ENST00000616878; ENSP00000480970; ENSG00000275136. [P24071-9] Ensembl; ENST00000616969; ENSP00000479039; ENSG00000275564. [P24071-5] Ensembl; ENST00000617025; ENSP00000481129; ENSG00000276985. [P24071-3] Ensembl; ENST00000617609; ENSP00000481394; ENSG00000274580. [P24071-10] Ensembl; ENST00000617696; ENSP00000482670; ENSG00000274580. [P24071-9] Ensembl; ENST00000617762; ENSP00000484136; ENSG00000276858. [P24071-5] Ensembl; ENST00000617766; ENSP00000479230; ENSG00000275269. [P24071-4] Ensembl; ENST00000617778; ENSP00000480498; ENSG00000273738. [P24071-3] Ensembl; ENST00000617964; ENSP00000484141; ENSG00000275564. [P24071-7] Ensembl; ENST00000618271; ENSP00000484741; ENSG00000276985. [P24071-7] Ensembl; ENST00000618287; ENSP00000481668; ENSG00000275564. [P24071-10] Ensembl; ENST00000618328; ENSP00000480496; ENSG00000276985. [P24071-10] Ensembl; ENST00000618658; ENSP00000479688; ENSG00000275970. [P24071-4] Ensembl; ENST00000618805; ENSP00000481985; ENSG00000275269. [P24071-2] Ensembl; ENST00000618985; ENSP00000480323; ENSG00000275269. [P24071-5] Ensembl; ENST00000619073; ENSP00000479360; ENSG00000273738. [P24071-8] Ensembl; ENST00000619155; ENSP00000480461; ENSG00000275970. [P24071-5] Ensembl; ENST00000619385; ENSP00000482334; ENSG00000275269. [P24071-1] Ensembl; ENST00000619414; ENSP00000478163; ENSG00000276858. [P24071-2] Ensembl; ENST00000619822; ENSP00000483250; ENSG00000275136. [P24071-2] Ensembl; ENST00000620162; ENSP00000483258; ENSG00000276858. [P24071-11] Ensembl; ENST00000620179; ENSP00000478315; ENSG00000278415. [P24071-7] Ensembl; ENST00000620270; ENSP00000482022; ENSG00000276985. [P24071-11] Ensembl; ENST00000620397; ENSP00000477584; ENSG00000276985. [P24071-5] Ensembl; ENST00000620801; ENSP00000481195; ENSG00000275970. [P24071-1] Ensembl; ENST00000620822; ENSP00000483327; ENSG00000275269. [P24071-7] Ensembl; ENST00000620873; ENSP00000479099; ENSG00000275269. [P24071-11] Ensembl; ENST00000621004; ENSP00000484816; ENSG00000275970. [P24071-10] Ensembl; ENST00000621009; ENSP00000482025; ENSG00000275970. [P24071-3] Ensembl; ENST00000621289; ENSP00000481366; ENSG00000275136. [P24071-5] Ensembl; ENST00000621417; ENSP00000478634; ENSG00000274580. [P24071-5] Ensembl; ENST00000621684; ENSP00000479239; ENSG00000276858. [P24071-3] Ensembl; ENST00000621702; ENSP00000482807; ENSG00000275136. [P24071-1] Ensembl; ENST00000621755; ENSP00000484906; ENSG00000275970. [P24071-7] Ensembl; ENST00000621882; ENSP00000484272; ENSG00000274580. [P24071-7] Ensembl; ENST00000622157; ENSP00000481502; ENSG00000275564. [P24071-1] Ensembl; ENST00000622470; ENSP00000477673; ENSG00000276858. [P24071-7] Ensembl; ENST00000622491; ENSP00000477643; ENSG00000274580. [P24071-8] Ensembl; ENST00000622543; ENSP00000483402; ENSG00000275564. [P24071-3] Ensembl; ENST00000622646; ENSP00000480406; ENSG00000273738. [P24071-7] Ensembl; ENST00000622737; ENSP00000479738; ENSG00000273738. [P24071-1] Ensembl; ENST00000622777; ENSP00000481345; ENSG00000275136. [P24071-10] Ensembl; ENST00000622883; ENSP00000479880; ENSG00000276858. [P24071-4] Ensembl; ENST00000622904; ENSP00000480444; ENSG00000275136. [P24071-11] Ensembl; ENST00000638206; ENSP00000492749; ENSG00000284061. [P24071-3] Ensembl; ENST00000638212; ENSP00000492230; ENSG00000284061. [P24071-1] Ensembl; ENST00000638238; ENSP00000492629; ENSG00000283750. [P24071-11] Ensembl; ENST00000638242; ENSP00000492364; ENSG00000283750. [P24071-8] Ensembl; ENST00000638244; ENSP00000492699; ENSG00000283953. [P24071-7] Ensembl; ENST00000638285; ENSP00000491595; ENSG00000284061. [P24071-8] Ensembl; ENST00000638290; ENSP00000492003; ENSG00000283750. [P24071-9] Ensembl; ENST00000638453; ENSP00000491493; ENSG00000284061. [P24071-4] Ensembl; ENST00000638527; ENSP00000491362; ENSG00000284245. [P24071-2] Ensembl; ENST00000638553; ENSP00000491372; ENSG00000284004. [P24071-7] Ensembl; ENST00000638625; ENSP00000492755; ENSG00000283953. [P24071-9] Ensembl; ENST00000638882; ENSP00000492226; ENSG00000283953. [P24071-3] Ensembl; ENST00000638900; ENSP00000491778; ENSG00000283953. [P24071-8] Ensembl; ENST00000638906; ENSP00000492268; ENSG00000283750. [P24071-7] Ensembl; ENST00000638945; ENSP00000492228; ENSG00000284245. [P24071-9] Ensembl; ENST00000638966; ENSP00000491307; ENSG00000283953. [P24071-11] Ensembl; ENST00000638995; ENSP00000491741; ENSG00000284004. [P24071-3] Ensembl; ENST00000639014; ENSP00000491039; ENSG00000284245. [P24071-8] Ensembl; ENST00000639163; ENSP00000491556; ENSG00000284061. [P24071-7] Ensembl; ENST00000639178; ENSP00000492137; ENSG00000284061. [P24071-2] Ensembl; ENST00000639193; ENSP00000491447; ENSG00000284004. [P24071-2] Ensembl; ENST00000639223; ENSP00000492274; ENSG00000284061. [P24071-10] Ensembl; ENST00000639337; ENSP00000491914; ENSG00000283750. [P24071-3] Ensembl; ENST00000639392; ENSP00000492068; ENSG00000283750. [P24071-2] Ensembl; ENST00000639402; ENSP00000492442; ENSG00000284245. [P24071-1] Ensembl; ENST00000639426; ENSP00000492415; ENSG00000284004. [P24071-10] Ensembl; ENST00000639428; ENSP00000491642; ENSG00000284061. [P24071-11] Ensembl; ENST00000639455; ENSP00000491849; ENSG00000284061. [P24071-9] Ensembl; ENST00000639575; ENSP00000492321; ENSG00000283953. [P24071-2] Ensembl; ENST00000639763; ENSP00000491420; ENSG00000284004. [P24071-8] Ensembl; ENST00000640025; ENSP00000492529; ENSG00000283750. [P24071-10] Ensembl; ENST00000640032; ENSP00000492077; ENSG00000284004. [P24071-9] Ensembl; ENST00000640047; ENSP00000490997; ENSG00000284245. [P24071-7] Ensembl; ENST00000640063; ENSP00000491889; ENSG00000284004. [P24071-11] Ensembl; ENST00000640070; ENSP00000491192; ENSG00000283750. [P24071-4] Ensembl; ENST00000640239; ENSP00000492762; ENSG00000283953. [P24071-1] Ensembl; ENST00000640405; ENSP00000491490; ENSG00000284004. [P24071-1] Ensembl; ENST00000640415; ENSP00000491274; ENSG00000284245. [P24071-10] Ensembl; ENST00000640430; ENSP00000492494; ENSG00000283953. [P24071-4] Ensembl; ENST00000640462; ENSP00000491298; ENSG00000284245. [P24071-3] Ensembl; ENST00000640562; ENSP00000492074; ENSG00000283750. [P24071-5] Ensembl; ENST00000640582; ENSP00000492447; ENSG00000283750. [P24071-1] Ensembl; ENST00000640584; ENSP00000491818; ENSG00000284061. [P24071-5] Ensembl; ENST00000640618; ENSP00000491815; ENSG00000284245. [P24071-5] Ensembl; ENST00000640687; ENSP00000492597; ENSG00000283953. [P24071-5] Ensembl; ENST00000640761; ENSP00000492411; ENSG00000284004. [P24071-4] Ensembl; ENST00000640811; ENSP00000492678; ENSG00000283953. [P24071-10] Ensembl; ENST00000640878; ENSP00000492686; ENSG00000284245. [P24071-11] Ensembl; ENST00000640908; ENSP00000492162; ENSG00000284245. [P24071-4] Ensembl; ENST00000640918; ENSP00000491746; ENSG00000284004. [P24071-5] GeneID; 2204; - KEGG; hsa:2204; - UCSC; uc002qhq.4; human. [P24071-1] CTD; 2204; - DisGeNET; 2204; - EuPathDB; HostDB:ENSG00000186431.18; - GeneCards; FCAR; - HGNC; HGNC:3608; FCAR HPA; HPA014050; - MIM; 147045; gene neXtProt; NX_P24071; - OpenTargets; ENSG00000186431; - PharmGKB; PA28055; - eggNOG; ENOG410IG5T; Eukaryota eggNOG; ENOG4111BK0; LUCA GeneTree; ENSGT00760000119033; - HOGENOM; HOG000234395; - HOVERGEN; HBG004337; - InParanoid; P24071; - KO; K06513; - OMA; VENWHSH; - OrthoDB; EOG091G0FVY; - PhylomeDB; P24071; - TreeFam; TF336644; - Reactome; R-HSA-6798695; Neutrophil degranulation ChiTaRS; FCAR; human EvolutionaryTrace; P24071; - GeneWiki; FCAR; - GenomeRNAi; 2204; - PRO; PR:P24071; - Proteomes; UP000005640; Chromosome 19 Bgee; ENSG00000186431; - CleanEx; HS_FCAR; - ExpressionAtlas; P24071; baseline and differential Genevisible; P24071; HS GO; GO:0005576; C:extracellular region; IEA:UniProtKB-SubCell GO; GO:0101003; C:ficolin-1-rich granule membrane; TAS:Reactome GO; GO:0005887; C:integral component of plasma membrane; TAS:ProtInc GO; GO:0005886; C:plasma membrane; IDA:CAFA GO; GO:0035579; C:specific granule membrane; TAS:Reactome GO; GO:0070821; C:tertiary granule membrane; TAS:Reactome GO; GO:0019862; F:IgA binding; IDA:CAFA GO; GO:0019766; F:IgA receptor activity; IDA:CAFA GO; GO:0097011; P:cellular response to granulocyte macrophage colony-stimulating factor stimulus; IDA:CAFA GO; GO:0035457; P:cellular response to interferon-alpha; IDA:CAFA GO; GO:0071346; P:cellular response to interferon-gamma; IDA:CAFA GO; GO:0071354; P:cellular response to interleukin-6; IDA:CAFA GO; GO:0071222; P:cellular response to lipopolysaccharide; IDA:CAFA GO; GO:0071356; P:cellular response to tumor necrosis factor; IDA:CAFA GO; GO:0038093; P:Fc receptor signaling pathway; IDA:CAFA GO; GO:0006955; P:immune response; TAS:ProtInc GO; GO:0042119; P:neutrophil activation; IDA:CAFA GO; GO:0043312; P:neutrophil degranulation; TAS:Reactome GO; GO:0002446; P:neutrophil mediated immunity; IDA:CAFA GO; GO:0033031; P:positive regulation of neutrophil apoptotic process; IDA:CAFA GO; GO:1903209; P:positive regulation of oxidative stress-induced cell death; IDA:CAFA Gene3D; 2.60.40.10; -; 2 InterPro; IPR036179; Ig-like_dom_sf InterPro; IPR013783; Ig-like_fold InterPro; IPR003599; Ig_sub SMART; SM00409; IG; 2 SUPFAM; SSF48726; SSF48726; 2 1: Evidence at protein level; 3D-structure; Alternative splicing; Cell membrane; Complete proteome; Disulfide bond; Glycoprotein; IgA-binding protein; Immunoglobulin domain; Membrane; Polymorphism; Receptor; Reference proteome; Repeat; Secreted; Signal; Transmembrane; Transmembrane helix SIGNAL 1 21 CHAIN 22 287 Immunoglobulin alpha Fc receptor /FTId=PRO_0000015138 TOPO_DOM 22 227 Extracellular. TRANSMEM 228 246 Helical. TOPO_DOM 247 287 Cytoplasmic. DOMAIN 42 107 Ig-like C2-type 1 DOMAIN 139 200 Ig-like C2-type 2 CARBOHYD 65 65 N-linked (GlcNAc...) asparagine CARBOHYD 79 79 N-linked (GlcNAc...) asparagine CARBOHYD 141 141 N-linked (GlcNAc...) asparagine CARBOHYD 177 177 N-linked (GlcNAc...) asparagine CARBOHYD 186 186 N-linked (GlcNAc...) asparagine CARBOHYD 198 198 N-linked (GlcNAc...) asparagine DISULFID 49 100 {ECO:0000244|PDB:1OVZ, ECO:0000244|PDB:1OW0, ECO:0000244|PDB:1UCT, ECO:0000269|PubMed:12768205, ECO:0000269|PubMed:12783876} DISULFID 146 193 {ECO:0000244|PDB:1OVZ, ECO:0000244|PDB:1OW0, ECO:0000244|PDB:1UCT, ECO:0000269|PubMed:12768205, ECO:0000269|PubMed:12783876} VAR_SEQ 12 23 Missing (in isoform B-delta-S2, isoform L10, isoform U09, isoform U10, isoform U11 and isoform U13) /FTId=VSP_002632 VAR_SEQ 24 120 Missing (in isoform L10) /FTId=VSP_043565 VAR_SEQ 24 24 G -> GRYISEHFWCRSLGCNPVNDASAQRPG (in isoform U02) /FTId=VSP_002633 VAR_SEQ 115 210 Missing (in isoform U10) /FTId=VSP_043566 VAR_SEQ 121 216 Missing (in isoform A.3) /FTId=VSP_002634 VAR_SEQ 193 287 CYGWYNRSPYLWSFPSNALELVVTDSIHQDYTTQNLIRMAV AGLVLVALLAILVENWHSHTALNKEASADVAEPSWSQQMCQ PGLTFARTPSVCK -> LHPPRLHDAELDPHGRGRTGPRGS LGHTG (in isoform U09) /FTId=VSP_043567 VAR_SEQ 195 216 Missing (in isoform A.2, isoform U02 and isoform U13) /FTId=VSP_002635 VAR_SEQ 217 287 DSIHQDYTTQNLIRMAVAGLVLVALLAILVENWHSHTALNK EASADVAEPSWSQQMCQPGLTFARTPSVCK -> GRYRPVQ PCVWVGCPGPCHRAGI (in isoform B and isoform B-delta-S2). /FTId=VSP_002636 VARIANT 113 113 D -> N (in dbSNP:rs11666735) /FTId=VAR_049996 VARIANT 269 269 S -> G (in dbSNP:rs16986050) /FTId=VAR_049997 HELIX 23 25 {ECO:0000244|PDB:1UCT} STRAND 31 35 {ECO:0000244|PDB:1UCT} STRAND 37 40 {ECO:0000244|PDB:1UCT} STRAND 45 49 {ECO:0000244|PDB:1UCT} STRAND 56 64 {ECO:0000244|PDB:1UCT} STRAND 67 70 {ECO:0000244|PDB:1UCT} STRAND 72 74 {ECO:0000244|PDB:1UCT} STRAND 77 79 {ECO:0000244|PDB:1OVZ} STRAND 84 87 {ECO:0000244|PDB:1UCT} HELIX 92 94 {ECO:0000244|PDB:1UCT} STRAND 96 104 {ECO:0000244|PDB:1UCT} TURN 105 107 {ECO:0000244|PDB:1UCT} STRAND 108 111 {ECO:0000244|PDB:1UCT} STRAND 115 120 {ECO:0000244|PDB:1UCT} STRAND 127 132 {ECO:0000244|PDB:1UCT} STRAND 134 136 {ECO:0000244|PDB:1UCT} STRAND 143 147 {ECO:0000244|PDB:1UCT} STRAND 149 151 {ECO:0000244|PDB:1UCT} STRAND 154 160 {ECO:0000244|PDB:1UCT} STRAND 168 171 {ECO:0000244|PDB:1UCT} STRAND 173 179 {ECO:0000244|PDB:1UCT} HELIX 185 187 {ECO:0000244|PDB:1UCT} STRAND 189 196 {ECO:0000244|PDB:1UCT} STRAND 198 200 {ECO:0000244|PDB:1OVZ} STRAND 211 215 {ECO:0000244|PDB:1UCT} SEQUENCE 287 AA; 32265 MW; A2CCA68467CD45F7 CRC64; MDPKQTTLLC LVLCLGQRIQ AQEGDFPMPF ISAKSSPVIP LDGSVKIQCQ AIREAYLTQL MIIKNSTYRE IGRRLKFWNE TDPEFVIDHM DANKAGRYQC QYRIGHYRFR YSDTLELVVT GLYGKPFLSA DRGLVLMPGE NISLTCSSAH IPFDRFSLAK EGELSLPQHQ SGEHPANFSL GPVDLNVSGI YRCYGWYNRS PYLWSFPSNA LELVVTDSIH QDYTTQNLIR MAVAGLVLVA LLAILVENWH SHTALNKEAS ADVAEPSWSQ QMCQPGLTFA RTPSVCK
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to
info@abgent.com, and receive a free "I Love Antibodies" mug.

Background

FCAR, Receptor for Fc fragment of IGA, is also known as CD89. Human Fc-alpha receptor(FCAR) is present on a number of cell types, including neutrophils, monocytes, macrophages, and eosinophils. FCAR interacts with aggregated IgAs, such as IgA coated on the surface of an invading microorganism, and mediates several immunologic defense processes such as phagocytosis, antibody-dependent cell-mediated cytotoxicity, and stimulation of the release of inflammatory mediators. FCAR is a glycoprotein of 50 to 100 kD, with diversity on different cell types. FCAR is mapped to 19q13.4. Human COS cells transfected with FCAR cDNA bind to IgA, but not IgG.

FeedBack
Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abgent.com.

$ 240.00
Cat# ABO10866
Size:
Quantity:
Availability: 3-5 days
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
“Crown Flash”  50 % off on 2,500+ Crown Antibodies. PromoCode:<span class=text-red> FLASH50
Terms & Conditions