Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Signal Transduction   >   Anti-Perilipin 3 Picoband Antibody   

Anti-Perilipin 3 Picoband Antibody

     
  • WB - Anti-Perilipin 3 Picoband Antibody ABO11631
    Western blot analysis of Perilipin 3 expression in rat liver extract (lane 1), mouse kidney extract (lane 2) and HELA whole cell lysates (lane 3). Perilipin 3 at 47KD was detected using rabbit anti- Perilipin 3 Antigen Affinity purified polyclonal antibody (Catalog # ABO11631) at 0.5 μg/mL. The blot was developed using chemiluminescence (ECL) method .
  • IHC - Anti-Perilipin 3 Picoband Antibody ABO11631
    Perilipin 3 was detected in paraffin-embedded sections of human lung cancer tissues using rabbit anti- Perilipin 3 Antigen Affinity purified polyclonal antibody (Catalog # ABO11631) at 1 ??g/mL. The immunohistochemical section was developed using SABC method .
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
WB, IHC-P
Primary Accession O60664
Host Rabbit
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Format Lyophilized
Description Rabbit IgG polyclonal antibody for Perilipin-3(PLIN3) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Additional Information
Gene ID 10226
Other Names Perilipin-3, 47 kDa mannose 6-phosphate receptor-binding protein, 47 kDa MPR-binding protein, Cargo selection protein TIP47, Mannose-6-phosphate receptor-binding protein 1, Placental protein 17, PP17, PLIN3, M6PRBP1, TIP47
Calculated MW 47075 MW KDa
Application Details Immunohistochemistry(Paraffin-embedded Section), 0.5-1 µg/ml, Human, By Heat

Western blot, 0.1-0.5 µg/ml, Human, Mouse, Rat
Subcellular Localization Cytoplasm . Endosome membrane ; Peripheral membrane protein ; Cytoplasmic side . Lipid droplet . Membrane associated on endosomes. Detected in the envelope and the core of lipid bodies and in lipid sails.
Protein Name Perilipin-3
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human Perilipin 3 (323-365aa ESRALTMFRDIAQQLQATCTSLGSSIQGLPTNVKDQVQQA RRQ), different from the related mouse sequence by fourteen amino acids.
Purification Immunogen affinity purified.
Cross Reactivity No cross reactivity with other proteins
Storage At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Information
Name PLIN3
Synonyms M6PRBP1, TIP47
Function Required for the transport of mannose 6-phosphate receptors (MPR) from endosomes to the trans-Golgi network.
Cellular Location Cytoplasm. Endosome membrane; Peripheral membrane protein; Cytoplasmic side. Lipid droplet Note=Membrane associated on endosomes. Detected in the envelope and the core of lipid bodies and in lipid sails.
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to
info@abgent.com, and receive a free "I Love Antibodies" mug.

Background

Mannose-6-phosphate receptor binding protein 1 (M6PRBP1), also known as Perilipin 3 (PLN3) or TIP47, is a protein which in humans is encoded by the M6PRBP1 gene. Mannose 6-phophate receptors (MPRs) deliver lysosomal hydrolase from the Golgi to endosomes and then return to the Golgi complex. The protein encoded by this gene interacts with the cytoplasmic domains of both cation-independent and cation-dependent MPRs, and is required for endosome-to-Golgi transport. This protein also binds directly to the GTPase RAB9 (RAB9A), a member of the RAS oncogene family. The interaction with RAB9 has been shown to increase the affinity of this protein for its cargo. Multiple transcript variants encoding different isoforms have been found for this gene.

FeedBack
Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abgent.com.

$ 280.00
Cat# ABO11631
Size:
Quantity:
Availability: 3-5 days
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
“Crown Flash”  50 % off on 2,500+ Crown Antibodies. PromoCode:<span class=text-red> FLASH50
Terms & Conditions