Register or Login
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Signal Transduction   >   Anti-Fascin Picoband Antibody   

Anti-Fascin Picoband Antibody

  • WB - Anti-Fascin Picoband Antibody ABO12278
    Anti- Fascin Picoband antibody, ABO12278, Western blottingAll lanes: Anti Fascin (ABO12278) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Rat Lung Tissue Lysate at 50ugLane 3: HELA Whole Cell Lysate at 40ugLane 4: SKOV Whole Cell Lysate at 40ugPredicted bind size: 55KDObserved bind size: 55KD
Product Information
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
Primary Accession Q16658
Host Rabbit
Reactivity Human, Rat
Clonality Polyclonal
Format Lyophilized
Description Rabbit IgG polyclonal antibody for Fascin(FSCN1) detection. Tested with WB in Human;Rat.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Additional Information
Gene ID 6624
Other Names Fascin, 55 kDa actin-bundling protein, Singed-like protein, p55, FSCN1, FAN1, HSN, SNL
Calculated MW 54530 MW KDa
Application Details Western blot, 0.1-0.5 µg/ml, Human, Rat
Subcellular Localization Cytoplasm, cytoskeleton. Cell projection, filopodium. Cell projection, invadopodium. Cytoplasm, cytosol. In glioma cells, partially colocalizes with F-actin stress fibers in the cytosol.
Tissue Specificity Ubiquitous.
Protein Name Fascin
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human Fascin (42-73aa KKQIWTLEQPPDEAGSAAVCLRSHLGRYLAAD), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.
Purification Immunogen affinity purified.
Cross Reactivity No cross reactivity with other proteins
Storage At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Sequence Similarities Belongs to the fascin family.
Protein Information
Name FSCN1
Synonyms FAN1, HSN, SNL
Function Organizes filamentous actin into bundles with a minimum of 4.1:1 actin/fascin ratio. Plays a role in the organization of actin filament bundles and the formation of microspikes, membrane ruffles, and stress fibers. Important for the formation of a diverse set of cell protrusions, such as filopodia, and for cell motility and migration.
Cellular Location Cytoplasm, cytosol Cytoplasm, cytoskeleton. Cell projection, filopodium. Cell projection, invadopodium. Cell projection, microvillus. Cell junction. Note=In glioma cells, partially colocalizes with F-actin stress fibers in the cytosol (PubMed:21706053). Colocalized with RUFY3 and F-actin at filipodia of the axonal growth cone. Colocalized with DBN1 and F-actin at the transitional domain of the axonal growth cone (By similarity) {ECO:0000250|UniProtKB:Q61553, ECO:0000269|PubMed:21706053}
Tissue Location Ubiquitous.
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to, and receive a free "I Love Antibodies" mug.


Fascin is an actin cross-linking protein. The Fascin gene contains 5 exons and spans 7 kb. It is a 54-58 kilodalton monomeric actin filament bundling protein originally isolated from sea urchin egg but also found in Drosophila and vertebrates, including humans. Fascin (from the Latin for bundle) is spaced at 11 nanometre intervals along the filament. The bundles in cross section are seen to be hexagonally packed, and the longitudinal spacing is compatible with a model where fascin cross-links at alternating 4 and 5 actins. It is calcium insensitive and monomeric. Fascin binds beta-catenin, and colocalizes with it at the leading edges and borders of epithelial and endothelial cells. The role of Fascin in regulating cytoskeletal structures for the maintenance of cell adhesion, coordinating motility and invasion through interactions with signalling pathways is an active area of research especially from the cancer biology perspective. Abnormal fascin expression or function has been implicated in breast cancer, colon cancer, esophageal squamous cell carcinoma, gallbladder cancer and prostate cancer.

Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at

$ 240.00
Cat# ABO12278
Availability: 3-5 days
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
“Crown Flash”  50 % off on 2,500+ Crown Antibodies. PromoCode:<span class=text-red> FLASH50
Terms & Conditions