Anti-PPP1R12A Picoband Antibody
- SPECIFICATION
- CITATIONS
- PROTOCOLS
- BACKGROUND
Application
| WB, IHC-P |
---|---|
Primary Accession | O14974 |
Host | Rabbit |
Reactivity | Human, Mouse |
Clonality | Polyclonal |
Format | Lyophilized |
Description | Rabbit IgG polyclonal antibody for Protein phosphatase 1 regulatory subunit 12A(PPP1R12A) detection. Tested with WB, IHC-P in Human;Mouse. |
Reconstitution | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Gene ID | 4659 |
---|---|
Other Names | Protein phosphatase 1 regulatory subunit 12A, Myosin phosphatase-targeting subunit 1, Myosin phosphatase target subunit 1, Protein phosphatase myosin-binding subunit, PPP1R12A, MBS, MYPT1 |
Calculated MW | 115281 MW KDa |
Application Details | Immunohistochemistry(Paraffin-embedded Section), 0.5-1 µg/ml, Human, By Heat Western blot, 0.1-0.5 µg/ml, Human, Mouse |
Subcellular Localization | Cytoplasm . Along actomyosin filaments and stress fibers. |
Tissue Specificity | Expressed in striated muscles, specifically in type 2a fibers (at protein level). . |
Protein Name | Protein phosphatase 1 regulatory subunit 12A |
Contents | Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human PPP1R12A (1-40aa MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDD), identical to the related mouse and rat sequences. |
Purification | Immunogen affinity purified. |
Cross Reactivity | No cross reactivity with other proteins. |
Storage | At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing. |
Name | PPP1R12A (HGNC:7618) |
---|---|
Function | Key regulator of protein phosphatase 1C (PPP1C). Mediates binding to myosin. As part of the PPP1C complex, involved in dephosphorylation of PLK1. Capable of inhibiting HIF1AN-dependent suppression of HIF1A activity. |
Cellular Location | Cytoplasm. Cytoplasm, cytoskeleton, stress fiber. Note=Also along actomyosin filaments |
Tissue Location | Expressed in striated muscles, specifically in type 2a fibers (at protein level). |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
info@abcepta.com, and receive a free "I Love Antibodies" mug.
Provided below are standard protocols that you may find useful for product applications.
Background
PPP1R12A (Protein phosphatase 1 regulatory subunit 12A), also called MYPT1 (Myosin phosphatase target subunit 1), is an enzyme that in humans is encoded by the PPP1R12A gene. PPP1R12A is one of the subunits of myosin phosphatase. Sequencing analysis showed that human PPP1R12A contains 1,030 amino acids with a calculated molecular mass of approximately 115 kD. The PPP1R12A gene is mapped on 12q21.2-q21.3. PPP1R12A is the protein that regulates PP1 function in smooth muscle relaxation. The cellular MYPT1-PP1-delta -specific inhibitor CPI17 caused a loss of merlin function characterized by merlin phosphorylation, Ras activation, and transformation. Jin et al. concluded that PPP1R12A and its substrate merlin are part of a previously undescribed tumor suppressor cascade that can be hindered in two ways, by mutation of the NF2 gene and by upregulation of the oncoprotein CPI17.
If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abcepta.com.