Anti-UNC5C Picoband Antibody
- SPECIFICATION
- CITATIONS
- PROTOCOLS
- BACKGROUND
Application
| WB |
---|---|
Primary Accession | O95185 |
Host | Rabbit |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Format | Lyophilized |
Description | Rabbit IgG polyclonal antibody for Netrin receptor UNC5C(UNC5C) detection. Tested with WB in Human;Mouse;Rat. |
Reconstitution | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Gene ID | 8633 |
---|---|
Other Names | Netrin receptor UNC5C, Protein unc-5 homolog 3, Protein unc-5 homolog C, UNC5C, UNC5H3 |
Calculated MW | 103146 MW KDa |
Application Details | Western blot, 0.1-0.5 µg/ml, Human, Mouse, Rat |
Subcellular Localization | Cell membrane ; Single-pass type I membrane protein . Cell junction, synapse, synaptosome . |
Tissue Specificity | Mainly expressed in brain. Also expressed in kidney. Not expressed in developing or adult lung. . |
Protein Name | Netrin receptor UNC5C |
Contents | Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human UNC5C (894-930aa DLWEAQNFPDGNLSMLAAVLEEMGRHETVVSLAAEGQ), identical to the related mouse and rat sequences. |
Purification | Immunogen affinity purified. |
Cross Reactivity | No cross reactivity with other proteins |
Storage | At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing. |
Name | UNC5C |
---|---|
Synonyms | UNC5H3 |
Function | Receptor for netrin required for axon guidance (By similarity). Mediates axon repulsion of neuronal growth cones in the developing nervous system upon ligand binding (By similarity). NTN1/Netrin-1 binding might cause dissociation of UNC5C from polymerized TUBB3 in microtubules and thereby lead to increased microtubule dynamics and axon repulsion (PubMed:28483977). Axon repulsion in growth cones may also be caused by its association with DCC that may trigger signaling for repulsion (By similarity). Might also collaborate with DSCAM in NTN1-mediated axon repulsion independently of DCC (By similarity). Also involved in corticospinal tract axon guidance independently of DCC (By similarity). Involved in dorsal root ganglion axon projection towards the spinal cord (PubMed:28483977). It also acts as a dependence receptor required for apoptosis induction when not associated with netrin ligand (By similarity). |
Cellular Location | Cell membrane; Single-pass type I membrane protein. Cell surface. Synapse, synaptosome {ECO:0000250|UniProtKB:Q761X5}. Cell projection, axon {ECO:0000250|UniProtKB:O08747}. Cell projection, dendrite {ECO:0000250|UniProtKB:O08747}. Cell projection, growth cone {ECO:0000250|UniProtKB:O08747}. Cell projection, lamellipodium {ECO:0000250|UniProtKB:O08747}. Cell projection, filopodium {ECO:0000250|UniProtKB:O08747} |
Tissue Location | Mainly expressed in brain (PubMed:9782087). Expressed in temporal lobe cortical neurons and in neurons of the hippocampal pyramidal layer (PubMed:25419706). Also expressed in kidney (PubMed:9782087). Not expressed in developing or adult lung (PubMed:9782087). |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
info@abcepta.com, and receive a free "I Love Antibodies" mug.
Provided below are standard protocols that you may find useful for product applications.
Background
Netrin receptor UNC5C is a protein that in humans is encoded by the UNC5C gene. This gene product belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediates the repellent response to netrin; they are transmembrane proteins containing 2 immunoglobulin (Ig)-like domains and 2 type I thrombospondin motifs in the extracellular region.
If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abcepta.com.