Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   TP1 / TEP1 Antibody (N-Terminus)   

TP1 / TEP1 Antibody (N-Terminus)

Rabbit Polyclonal Antibody

     
  • IF - TP1 / TEP1 Antibody (N-Terminus) ALS11487
    Immunofluorescence of TP-1 in Human Lung cells with TP-1 antibody at 20 ug/ml.
  • WB - TP1 / TEP1 Antibody (N-Terminus) ALS11487
    Western blot of TP1 in human kidney tissue lysate with TP1 antibody at (A) 1 and (B) 2 ug/ml.
  • IHC - TP1 / TEP1 Antibody (N-Terminus) ALS11487
    Anti-TEP1 antibody IHC of human skin.
  • IHC - TP1 / TEP1 Antibody (N-Terminus) ALS11487
    Anti-TEP1 antibody IHC of human breast.
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
WB, IHC-P, IF
Primary Accession Q99973
Reactivity Human, Mouse, Rat
Host Rabbit
Clonality Polyclonal
Calculated MW 290kDa
Dilution IHC-P (5 µg/ml)
Additional Information
Other Names Telomerase protein component 1, Telomerase-associated protein 1, Telomerase protein 1, p240, p80 telomerase homolog, TEP1, TLP1, TP1
Target/Specificity 20 amino acid peptide from near the amino terminus of human TP1.
Reconstitution & Storage Short term 4°C, long term aliquot and store at -20°C, avoid freeze thaw cycles. Store undiluted.
PrecautionsTP1 / TEP1 Antibody (N-Terminus) is for research use only and not for use in diagnostic or therapeutic procedures.
Protein Information
Name TEP1
Synonyms TLP1, TP1
Function Component of the telomerase ribonucleoprotein complex that is essential for the replication of chromosome termini. Also component of the ribonucleoprotein vaults particle, a multi- subunit structure involved in nucleo-cytoplasmic transport. Responsible for the localizing and stabilizing vault RNA (vRNA) association in the vault ribonucleoprotein particle. Binds to TERC (By similarity).
Cellular Location Nucleus. Chromosome, telomere.
Tissue Location Ubiquitous.. EMBL; U86136; AAC51107.1; -; mRNA EMBL; BC126107; AAI26108.1; -; mRNA EMBL; BX640983; CAE45993.1; -; mRNA CCDS; CCDS9548.1; -. [Q99973-1] RefSeq; NP_009041.2; NM_007110.4. [Q99973-1] RefSeq; XP_005268084.1; XM_005268027.4. [Q99973-1] UniGene; Hs.508835; - ProteinModelPortal; Q99973; - BioGrid; 112870; 14 IntAct; Q99973; 3 STRING; 9606.ENSP00000262715; - iPTMnet; Q99973; - PhosphoSitePlus; Q99973; - SwissPalm; Q99973; - BioMuta; TEP1; - DMDM; 215273899; - EPD; Q99973; - MaxQB; Q99973; - PaxDb; Q99973; - PeptideAtlas; Q99973; - PRIDE; Q99973; - ProteomicsDB; 78559; - ProteomicsDB; 78560; -. [Q99973-2] Ensembl; ENST00000262715; ENSP00000262715; ENSG00000129566. [Q99973-1] GeneID; 7011; - KEGG; hsa:7011; - UCSC; uc001vxe.4; human. [Q99973-1] CTD; 7011; - DisGeNET; 7011; - EuPathDB; HostDB:ENSG00000129566.12; - GeneCards; TEP1; - H-InvDB; HIX0026646; - HGNC; HGNC:11726; TEP1 HPA; HPA029206; - MIM; 601686; gene neXtProt; NX_Q99973; - OpenTargets; ENSG00000129566; - PharmGKB; PA36443; - eggNOG; KOG3602; Eukaryota eggNOG; KOG4155; Eukaryota eggNOG; ENOG410XP3K; LUCA GeneTree; ENSGT00910000144185; - HOGENOM; HOG000154545; - HOVERGEN; HBG059633; - InParanoid; Q99973; - KO; K11127; - OMA; AQLWKTC; - OrthoDB; EOG091G003L; - PhylomeDB; Q99973; - TreeFam; TF328424; - SignaLink; Q99973; - ChiTaRS; TEP1; human GeneWiki; TEP1; - GenomeRNAi; 7011; - PRO; PR:Q99973; - Proteomes; UP000005640; Chromosome 14 Bgee; ENSG00000129566; - CleanEx; HS_TEP1; - ExpressionAtlas; Q99973; baseline and differential Genevisible; Q99973; HS GO; GO:0071013; C:catalytic step 2 spliceosome; IBA:GO_Central GO; GO:0000781; C:chromosome, telomeric region; IEA:UniProtKB-SubCell GO; GO:0005737; C:cytoplasm; IDA:MGI GO; GO:0016363; C:nuclear matrix; IDA:MGI GO; GO:0071011; C:precatalytic spliceosome; IBA:GO_Central GO; GO:1990904; C:ribonucleoprotein complex; TAS:UniProtKB GO; GO:0005697; C:telomerase holoenzyme complex; IDA:UniProtKB GO; GO:0005682; C:U5 snRNP; IBA:GO_Central GO; GO:0005524; F:ATP binding; IEA:UniProtKB-KW GO; GO:0019899; F:enzyme binding; IPI:BHF-UCL GO; GO:0002039; F:p53 binding; IPI:BHF-UCL GO; GO:0003723; F:RNA binding; ISS:UniProtKB GO; GO:0003720; F:telomerase activity; IEA:Ensembl GO; GO:0070034; F:telomerase RNA binding; ISS:BHF-UCL GO; GO:0008380; P:RNA splicing; IBA:GO_Central GO; GO:0000722; P:telomere maintenance via recombination; IDA:UniProtKB Gene3D; 2.130.10.10; -; 6 InterPro; IPR025139; DUF4062 InterPro; IPR007111; NACHT_NTPase InterPro; IPR027417; P-loop_NTPase InterPro; IPR008850; TEP1_N InterPro; IPR008858; TROVE_dom InterPro; IPR037214; TROVE_dom_sf InterPro; IPR015943; WD40/YVTN_repeat-like_dom_sf InterPro; IPR001680; WD40_repeat InterPro; IPR019775; WD40_repeat_CS InterPro; IPR017986; WD40_repeat_dom InterPro; IPR036322; WD40_repeat_dom_sf Pfam; PF13271; DUF4062; 1 Pfam; PF05729; NACHT; 1 Pfam; PF05386; TEP1_N; 4 Pfam; PF05731; TROVE; 1 Pfam; PF00400; WD40; 5 SMART; SM00320; WD40; 18 SUPFAM; SSF140864; SSF140864; 3 SUPFAM; SSF50978; SSF50978; 5 SUPFAM; SSF52540; SSF52540; 1 PROSITE; PS50837; NACHT; 1 PROSITE; PS51226; TEP1_N; 4 PROSITE; PS50988; TROVE; 1 PROSITE; PS00678; WD_REPEATS_1; 1 PROSITE; PS50082; WD_REPEATS_2; 7 PROSITE; PS50294; WD_REPEATS_REGION; 2 1: Evidence at protein level; Alternative splicing; ATP-binding; Chromosome; Complete proteome; Nucleotide-binding; Nucleus; Polymorphism; Reference proteome; Repeat; Ribonucleoprotein; RNA-binding; Telomere; WD repeat CHAIN 1 2627 Telomerase protein component 1 /FTId=PRO_0000050982 REPEAT 1 30 TEP1 N-terminal 1 REPEAT 31 60 TEP1 N-terminal 2 REPEAT 61 90 TEP1 N-terminal 3 REPEAT 91 120 TEP1 N-terminal 4 DOMAIN 223 676 TROVE. {ECO:0000255|PROSITE- ProRule:PRU00343} DOMAIN 1162 1490 NACHT. {ECO:0000255|PROSITE- ProRule:PRU00136} REPEAT 1411 1448 WD 1 REPEAT 1674 1713 WD 2 REPEAT 1716 1754 WD 3 REPEAT 1757 1796 WD 4 REPEAT 1798 1837 WD 5 REPEAT 1840 1879 WD 6 REPEAT 1882 1921 WD 7 REPEAT 1925 1964 WD 8 REPEAT 1967 2005 WD 9 REPEAT 2008 2047 WD 10 REPEAT 2059 2098 WD 11 REPEAT 2105 2143 WD 12 REPEAT 2146 2183 WD 13 REPEAT 2185 2233 WD 14 REPEAT 2236 2275 WD 15 REPEAT 2278 2317 WD 16 REPEAT 2319 2355 WD 17 REPEAT 2368 2417 WD 18 REPEAT 2459 2500 WD 19 REPEAT 2553 2590 WD 20 REPEAT 2592 2626 WD 21 NP_BIND 1168 1175 ATP. {ECO:0000255|PROSITE- ProRule:PRU00136} VAR_SEQ 2475 2506 ESSFLCASSDGILWNLAKCSPEGEWTTGNMWQ -> ALMGS YGTWPNAAQKENGPQVTCGR (in isoform 2) /FTId=VSP_010359 VARIANT 116 116 S -> P (in dbSNP:rs1760897) /FTId=VAR_018490 VARIANT 137 137 T -> M (in dbSNP:rs10083536) /FTId=VAR_047631 VARIANT 307 307 N -> K (in dbSNP:rs1760898) /FTId=VAR_018491 VARIANT 368 368 K -> R (in dbSNP:rs2228035) /FTId=VAR_047632 VARIANT 434 434 K -> N (in dbSNP:rs17111188) /FTId=VAR_047633 VARIANT 510 510 S -> L (in dbSNP:rs4982051) /FTId=VAR_047634 VARIANT 553 553 A -> G (in dbSNP:rs76466486) /FTId=VAR_047635 VARIANT 933 933 R -> H (in dbSNP:rs34179031) /FTId=VAR_047636 VARIANT 1055 1055 R -> C (in dbSNP:rs1760903) /FTId=VAR_018492 VARIANT 1155 1155 R -> Q (in dbSNP:rs2228041) /FTId=VAR_047637 VARIANT 1195 1195 S -> P (in dbSNP:rs1760904) /FTId=VAR_018493 VARIANT 1351 1351 R -> Q (in dbSNP:rs12886088) /FTId=VAR_047638 VARIANT 1408 1408 G -> R (in dbSNP:rs2229100) /FTId=VAR_047639 VARIANT 1447 1447 S -> T (in dbSNP:rs1713457) /FTId=VAR_018494 VARIANT 1468 1468 C -> Y (in dbSNP:rs1713456) /FTId=VAR_018495 VARIANT 1661 1661 R -> Q (in dbSNP:rs34401320) /FTId=VAR_047640 VARIANT 1772 1772 R -> Q (in dbSNP:rs8022805) /FTId=VAR_047641 VARIANT 2214 2214 V -> I (in dbSNP:rs1713449) /FTId=VAR_018496 VARIANT 2310 2310 A -> S (in dbSNP:rs35929175) /FTId=VAR_047642 VARIANT 2486 2486 I -> M (in dbSNP:rs938886) /FTId=VAR_018497 VARIANT 2562 2562 H -> R (in dbSNP:rs2104978) /FTId=VAR_018498 SEQUENCE 2627 AA; 290490 MW; 32628238704A8860 CRC64; MEKLHGHVSA HPDILSLENR CLAMLPDLQP LEKLHQHVST HSDILSLKNQ CLATLPDLKT MEKPHGYVSA HPDILSLENQ CLATLSDLKT MEKPHGHVSA HPDILSLENR CLATLSSLKS TVSASPLFQS LQISHMTQAD LYRVNNSNCL LSEPPSWRAQ HFSKGLDLST CPIALKSISA TETAQEATLG RWFDSEEKKG AETQMPSYSL SLGEEEEVED LAVKLTSGDS ESHPEPTDHV LQEKKMALLS LLCSTLVSEV NMNNTSDPTL AAIFEICREL ALLEPEFILK ASLYARQQLN VRNVANNILA IAAFLPACRP HLRRYFCAIV QLPSDWIQVA ELYQSLAEGD KNKLVPLPAC LRTAMTDKFA QFDEYQLAKY NPRKHRAKRH PRRPPRSPGM EPPFSHRCFP RYIGFLREEQ RKFEKAGDTV SEKKNPPRFT LKKLVQRLHI HKPAQHVQAL LGYRYPSNLQ LFSRSRLPGP WDSSRAGKRM KLSRPETWER ELSLRGNKAS VWEELIENGK LPFMAMLRNL CNLLRVGISS RHHELILQRL QHAKSVIHSR QFPFRFLNAH DAIDALEAQL RNQALPFPSN ITLMRRILTR NEKNRPRRRF LCHLSRQQLR MAMRIPVLYE QLKREKLRVH KARQWKYDGE MLNRYRQALE TAVNLSVKHS LPLLPGRTVL VYLTDANADR LCPKSNPQGP PLNYALLLIG MMITRAEQVD VVLCGGDTLK TAVLKAEEGI LKTAIKLQAQ VQEFDENDGW SLNTFGKYLL SLAGQRVPVD RVILLGQSMD DGMINVAKQL YWQRVNSKCL FVGILLRRVQ YLSTDLNPND VTLSGCTDAI LKFIAEHGAS HLLEHVGQMD KIFKIPPPPG KTGVQSLRPL EEDTPSPLAP VSQQGWRSIR LFISSTFRDM HGERDLLLRS VLPALQARAA PHRISLHGID LRWGVTEEET RRNRQLEVCL GEVENAQLFV GILGSRYGYI PPSYNLPDHP HFHWAQQYPS GRSVTEMEVM QFLNRNQRLQ PSAQALIYFR DSSFLSSVPD AWKSDFVSES EEAARRISEL KSYLSRQKGI TCRRYPCEWG GVAAGRPYVG GLEEFGQLVL QDVWNMIQKL YLQPGALLEQ PVSIPDDDLV QATFQQLQKP PSPARPRLLQ DTVQRLMLPH GRLSLVTGQS GQGKTAFLAS LVSALQAPDG AKVASLVFFH FSGARPDQGL ALTLLRRLCT YLRGQLKEPG ALPSTYRSLV WELQQRLLPK SAESLHPGQT QVLIIDGADR LVDQNGQLIS DWIPKKLPRC VHLVLSVSSD AGLGETLEQS QGAHVLALGP LEASARARLV REELALYGKR LEESPFNNQM RLLLVKRESG RPLYLRLVTD HLRLFTLYEQ VSERLRTLPA TVPLLLQHIL STLEKEHGPD VLPQALTALE VTRSGLTVDQ LHGVLSVWRT LPKGTKSWEE AVAAGNSGDP YPMGPFACLV QSLRSLLGEG PLERPGARLC LPDGPLRTAA KRCYGKRPGL EDTAHILIAA QLWKTCDADA SGTFRSCPPE ALGDLPYHLL QSGNRGLLSK FLTNLHVVAA HLELGLVSRL LEAHALYASS VPKEEQKLPE ADVAVFRTFL RQQASILSQY PRLLPQQAAN QPLDSPLCHQ ASLLSRRWHL QHTLRWLNKP RTMKNQQSSS LSLAVSSSPT AVAFSTNGQR AAVGTANGTV YLLDLRTWQE EKSVVSGCDG ISACLFLSDD TLFLTAFDGL LELWDLQHGC RVLQTKAHQY QITGCCLSPD CRLLATVCLG GCLKLWDTVR GQLAFQHTYP KSLNCVAFHP EGQVIATGSW AGSISFFQVD GLKVTKDLGA PGASIRTLAF NVPGGVVAVG RLDSMVELWA WREGARLAAF PAHHGFVAAA LFLHAGCQLL TAGEDGKVQV WSGSLGRPRG HLGSLSLSPA LSVALSPDGD RVAVGYRADG IRIYKISSGS QGAQGQALDV AVSALAWLSP KVLVSGAEDG SLQGWALKEC SLQSLWLLSR FQKPVLGLAT SQELLASASE DFTVQLWPRQ LLTRPHKAED FPCGTELRGH EGPVSCCSFS TDGGSLATGG RDRSLLCWDV RTPKTPVLIH SFPACHRDWV TGCAWTKDNL LISCSSDGSV GLWDPESGQR LGQFLGHQSA VSAVAAVEEH VVSVSRDGTL KVWDHQGVEL TSIPAHSGPI SHCAAAMEPR AAGQPGSELL VVTVGLDGAT RLWHPLLVCQ THTLLGHSGP VRAAAVSETS GLMLTASEDG SVRLWQVPKE ADDTCIPRSS AAVTAVAWAP DGSMAVSGNQ AGELILWQEA KAVATAQAPG HIGALIWSSA HTFFVLSADE KISEWQVKLR KGSAPGNLSL HLNRILQEDL GVLTSLDWAP DGHFLILAKA DLKLLCMKPG DAPSEIWSSY TENPMILSTH KEYGIFVLQP KDPGVLSFLR QKESGEFEER LNFDINLENP SRTLISITQA KPESESSFLC ASSDGILWNL AKCSPEGEWT TGNMWQKKAN TPETQTPGTD PSTCRESDAS MDSDASMDSE PTPHLKTRQR RKIHSGSVTA LHVLPELLVT ASKDRDVKLW ERPSMQLLGL FRCEGSVSCL EPWLGANSTL QLAVGDVQGN VYFLNWE
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to
info@abgent.com, and receive a free "I Love Antibodies" mug.

Background

Component of the telomerase ribonucleoprotein complex that is essential for the replication of chromosome termini. Also component of the ribonucleoprotein vaults particle, a multi- subunit structure involved in nucleo-cytoplasmic transport. Responsible for the localizing and stabilizing vault RNA (vRNA) association in the vault ribonucleoprotein particle. Binds to TERC (By similarity).

References

Harrington L.,et al.Science 275:973-977(1997).
Bechtel S.,et al.BMC Genomics 8:399-399(2007).
Harrington L.,et al.Genes Dev. 11:3109-3115(1997).
Kickhoefer V.A.,et al.J. Biol. Chem. 274:32712-32717(1999).
Beattie T.L.,et al.Mol. Biol. Cell 11:3329-3340(2000).

FeedBack
Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abgent.com.

$ 425.00
Cat# ALS11487
Size:
Quantity:
Availability: 5 days
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
“Crown Flash”  50 % off on 2,500+ Crown Antibodies. PromoCode:<span class=text-red> FLASH50
Terms & Conditions