Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Signal Transduction   >   PPP2R3A / PR130 Antibody (Internal)   

PPP2R3A / PR130 Antibody (Internal)

Goat Polyclonal Antibody

     
  • IHC - PPP2R3A / PR130 Antibody (Internal) ALS12331
    Anti-PPP2R3A antibody IHC of human brain, cerebellum.
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
WB, IHC-P, E
Primary Accession Q06190
Reactivity Human, Mouse, Rabbit, Monkey, Pig, Horse
Host Goat
Clonality Polyclonal
Calculated MW 130kDa
Dilution ELISA (1:16000), IHC-P (5 µg/ml), WB (1 µg/ml)
Additional Information
Other Names Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha, PP2A subunit B isoform PR72/PR130, PP2A subunit B isoform R3 isoform, PP2A subunit B isoforms B''-PR72/PR130, PP2A subunit B isoforms B72/B130, Serine/threonine-protein phosphatase 2A 72/130 kDa regulatory subunit B, PPP2R3A, PPP2R3
Target/Specificity Human PPP2R3A. This antibody is expected to recognise both reported isoforms (NP_002709.2; NP_871626.1).
Reconstitution & Storage Store at -20°C. Minimize freezing and thawing.
PrecautionsPPP2R3A / PR130 Antibody (Internal) is for research use only and not for use in diagnostic or therapeutic procedures.
Protein Information
Name PPP2R3A
Synonyms PPP2R3
Function The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.
Tissue Location Expressed in heart, brain, placenta, lung, muscle and kidney EMBL; L07590; AAB02613.1; -; mRNA EMBL; L12146; AAB02614.1; -; mRNA EMBL; AK293012; BAF85701.1; -; mRNA EMBL; AK298059; BAG60353.1; -; mRNA EMBL; AK316258; BAH14629.1; -; mRNA EMBL; AC072039; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; AC092991; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; CH471052; EAW79122.1; -; Genomic_DNA EMBL; CH471052; EAW79123.1; -; Genomic_DNA EMBL; AL389975; CAB97532.1; -; mRNA CCDS; CCDS3087.1; -. [Q06190-1] CCDS; CCDS3088.1; -. [Q06190-2] CCDS; CCDS54642.1; -. [Q06190-3] PIR; A47114; A47114 PIR; B47114; B47114 RefSeq; NP_001177376.1; NM_001190447.1. [Q06190-3] RefSeq; NP_002709.2; NM_002718.4. [Q06190-1] RefSeq; NP_871626.1; NM_181897.2. [Q06190-2] RefSeq; XP_006713749.1; XM_006713686.3. [Q06190-1] RefSeq; XP_011511258.1; XM_011512956.2. [Q06190-1] UniGene; Hs.518155; - PDB; 4I5J; X-ray; 2.09 A; A=786-1070 PDB; 4I5K; X-ray; 2.90 A; A/B=786-1070 PDBsum; 4I5J; - PDBsum; 4I5K; - ProteinModelPortal; Q06190; - SMR; Q06190; - BioGrid; 111515; 30 CORUM; Q06190; - DIP; DIP-29397N; - IntAct; Q06190; 9 MINT; Q06190; - STRING; 9606.ENSP00000264977; - iPTMnet; Q06190; - PhosphoSitePlus; Q06190; - BioMuta; PPP2R3A; - DMDM; 543720; - EPD; Q06190; - MaxQB; Q06190; - PaxDb; Q06190; - PeptideAtlas; Q06190; - PRIDE; Q06190; - ProteomicsDB; 58420; - ProteomicsDB; 58421; -. [Q06190-2] Ensembl; ENST00000264977; ENSP00000264977; ENSG00000073711. [Q06190-1] Ensembl; ENST00000334546; ENSP00000334748; ENSG00000073711. [Q06190-2] Ensembl; ENST00000490467; ENSP00000419344; ENSG00000073711. [Q06190-3] GeneID; 5523; - KEGG; hsa:5523; - UCSC; uc003eqv.3; human. [Q06190-1] CTD; 5523; - DisGeNET; 5523; - EuPathDB; HostDB:ENSG00000073711.10; - GeneCards; PPP2R3A; - HGNC; HGNC:9307; PPP2R3A HPA; HPA035829; - HPA; HPA035830; - HPA; HPA065338; - MIM; 604944; gene neXtProt; NX_Q06190; - OpenTargets; ENSG00000073711; - PharmGKB; PA35523; - eggNOG; KOG2562; Eukaryota eggNOG; ENOG410XRBK; LUCA GeneTree; ENSGT00530000063265; - HOGENOM; HOG000013216; - HOVERGEN; HBG000013; - KO; K11583; - OMA; SCLTRII; - OrthoDB; EOG091G03UQ; - PhylomeDB; Q06190; - TreeFam; TF105554; - ChiTaRS; PPP2R3A; human GeneWiki; PPP2R3A; - GenomeRNAi; 5523; - PRO; PR:Q06190; - Proteomes; UP000005640; Chromosome 3 Bgee; ENSG00000073711; - CleanEx; HS_PPP2R3A; - ExpressionAtlas; Q06190; baseline and differential Genevisible; Q06190; HS GO; GO:0000159; C:protein phosphatase type 2A complex; IDA:BHF-UCL GO; GO:0005509; F:calcium ion binding; IEA:InterPro GO; GO:0030674; F:protein binding, bridging; IDA:BHF-UCL GO; GO:0019888; F:protein phosphatase regulator activity; TAS:ProtInc GO; GO:0001754; P:eye photoreceptor cell differentiation; IGI:BHF-UCL GO; GO:0090090; P:negative regulation of canonical Wnt signaling pathway; IGI:BHF-UCL GO; GO:0090263; P:positive regulation of canonical Wnt signaling pathway; IDA:BHF-UCL GO; GO:0045732; P:positive regulation of protein catabolic process; IMP:BHF-UCL GO; GO:0006470; P:protein dephosphorylation; ISS:UniProtKB GO; GO:0090249; P:regulation of cell motility involved in somitogenic axis elongation; IGI:BHF-UCL GO; GO:0007525; P:somatic muscle development; IGI:BHF-UCL GO; GO:0061053; P:somite development; ISS:BHF-UCL GO; GO:0090244; P:Wnt signaling pathway involved in somitogenesis; IC:BHF-UCL InterPro; IPR011992; EF-hand-dom_pair InterPro; IPR018247; EF_Hand_1_Ca_BS InterPro; IPR002048; EF_hand_dom Pfam; PF13499; EF-hand_7; 1 SUPFAM; SSF47473; SSF47473; 2 PROSITE; PS00018; EF_HAND_1; 1 PROSITE; PS50222; EF_HAND_2; 2 1: Evidence at protein level; 3D-structure; Alternative splicing; Calcium; Complete proteome; Direct protein sequencing; Metal-binding; Polymorphism; Reference proteome; Repeat CHAIN 1 1150 Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha /FTId=PRO_0000071443 DOMAIN 758 793 EF-hand 1. {ECO:0000255|PROSITE- ProRule:PRU00448} DOMAIN 972 1007 EF-hand 2. {ECO:0000255|PROSITE- ProRule:PRU00448} CA_BIND 985 996 {ECO:0000255|PROSITE-ProRule:PRU00448} COMPBIAS 670 695 Pro-rich VAR_SEQ 1 736 Missing (in isoform 3) /FTId=VSP_045203 VAR_SEQ 1 621 Missing (in isoform PR72) /FTId=VSP_005107 VAR_SEQ 622 665 MQILQETLTTSSQANLSVCRSPVGDKAKDTTSAVLIQQTPE VIK -> MMIKETSLRRDPDLRGELAFLARGCDFVLPSRFK KRLKSFQQTQ (in isoform PR72) /FTId=VSP_005108 VARIANT 67 67 D -> G (in dbSNP:rs9814557) /FTId=VAR_051739 VARIANT 67 67 D -> N (in dbSNP:rs57374999) /FTId=VAR_061760 VARIANT 108 108 N -> S (in dbSNP:rs36020282) /FTId=VAR_051740 VARIANT 171 171 A -> S (in dbSNP:rs6779903) /FTId=VAR_051741 VARIANT 481 481 P -> A (in dbSNP:rs34901937) /FTId=VAR_051742 VARIANT 642 642 S -> G (in dbSNP:rs17197552) /FTId=VAR_051743 VARIANT 695 695 P -> L (in dbSNP:rs9826032) /FTId=VAR_051744 VARIANT 745 745 D -> N (in dbSNP:rs16843645) /FTId=VAR_022095 HELIX 797 805 {ECO:0000244|PDB:4I5J} STRAND 811 813 {ECO:0000244|PDB:4I5J} HELIX 815 818 {ECO:0000244|PDB:4I5J} HELIX 819 828 {ECO:0000244|PDB:4I5J} TURN 830 832 {ECO:0000244|PDB:4I5J} HELIX 833 837 {ECO:0000244|PDB:4I5J} HELIX 839 857 {ECO:0000244|PDB:4I5J} STRAND 861 863 {ECO:0000244|PDB:4I5K} HELIX 867 871 {ECO:0000244|PDB:4I5J} HELIX 875 882 {ECO:0000244|PDB:4I5J} HELIX 888 890 {ECO:0000244|PDB:4I5J} TURN 892 895 {ECO:0000244|PDB:4I5J} HELIX 897 910 {ECO:0000244|PDB:4I5J} STRAND 915 919 {ECO:0000244|PDB:4I5K} HELIX 920 923 {ECO:0000244|PDB:4I5J} TURN 924 929 {ECO:0000244|PDB:4I5J} HELIX 933 939 {ECO:0000244|PDB:4I5J} TURN 940 944 {ECO:0000244|PDB:4I5J} HELIX 958 969 {ECO:0000244|PDB:4I5J} HELIX 974 984 {ECO:0000244|PDB:4I5J} STRAND 989 992 {ECO:0000244|PDB:4I5J} HELIX 994 1010 {ECO:0000244|PDB:4I5J} HELIX 1018 1029 {ECO:0000244|PDB:4I5J} HELIX 1039 1045 {ECO:0000244|PDB:4I5J} HELIX 1048 1056 {ECO:0000244|PDB:4I5J} HELIX 1058 1062 {ECO:0000244|PDB:4I5J} SEQUENCE 1150 AA; 130278 MW; 97A31BA4206518A3 CRC64; MAATYRLVVS TVNHYSSVVI DRRFEQAIHY CTGTCHTFTH GIDCIVVHHS VCADLLHIPV SQFKDADLNS MFLPHENGLS SAEGDYPQQA FTGIPRVKRG STFQNTYNLK DIAGEAISFA SGKIKEFSFE KLKNSNHAAY RKGRKVKSDS FNRRSVDLDL LCGHYNNDGN APSFGLLRSS SVEEKPLSHR NSLDTNLTSM FLQNFSEEDL VTQILEKHKI DNFSSGTDIK MCLDILLKCS EDLKKCTDII KQCIKKKSGS SISEGSGNDT ISSSETVYMN VMTRLASYLK KLPFEFMQSG NNEALDLTEL ISNMPSLQLT PFSPVFGTEQ PPKYEDVVQL SASDSGRFQT IELQNDKPNS RKMDTVQSIP NNSTNSLYNL EVNDPRTLKA VQVQSQSLTM NPLENVSSDD LMETLYIEEE SDGKKALDKG QKTENGPSHE LLKVNEHRAE FPEHATHLKK CPTPMQNEIG KIFEKSFVNL PKEDCKSKVS KFEEGDQRDF TNSSSQEEID KLLMDLESFS QKMETSLREP LAKGKNSNFL NSHSQLTGQT LVDLEPKSKV SSPIEKVSPS CLTRIIETNG HKIEEEDRAL LLRILESIED FAQELVECKS SRGSLSQEKE MMQILQETLT TSSQANLSVC RSPVGDKAKD TTSAVLIQQT PEVIKIQNKP EKKPGTPLPP PATSPSSPRP LSPVPHVNNV VNAPLSINIP RFYFPEGLPD TCSNHEQTLS RIETAFMDIE EQKADIYEMG KIAKVCGCPL YWKAPMFRAA GGEKTGFVTA QSFIAMWRKL LNNHHDDASK FICLLAKPNC SSLEQEDFIP LLQDVVDTHP GLTFLKDAPE FHSRYITTVI QRIFYTVNRS WSGKITSTEI RKSNFLQTLA LLEEEEDINQ ITDYFSYEHF YVIYCKFWEL DTDHDLYISQ ADLSRYNDQA SSSRIIERIF SGAVTRGKTI QKEGRMSYAD FVWFLISEED KRNPTSIEYW FRCMDVDGDG VLSMYELEYF YEEQCERMEA MGIEPLPFHD LLCQMLDLVK PAVDGKITLR DLKRCRMAHI FYDTFFNLEK YLDHEQRDPF AVQKDVENDG PEPSDWDRFA AEEYETLVAE ESAQAQFQEG FEDYETDEPA SPSEFGNKSN KILSASLPEK CGKLQSVDEE
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to
info@abgent.com, and receive a free "I Love Antibodies" mug.

Background

The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.

References

Hendrix P.,et al.J. Biol. Chem. 268:15267-15276(1993).
Ota T.,et al.Nat. Genet. 36:40-45(2004).
Muzny D.M.,et al.Nature 440:1194-1198(2006).
Mural R.J.,et al.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases.

FeedBack
Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abgent.com.

$ 425.00
Cat# ALS12331
Size:
Quantity:
Availability: 5 days
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
“Crown Flash”  50 % off on 2,500+ Crown Antibodies. PromoCode:<span class=text-red> FLASH50
Terms & Conditions