Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   ZBP1 Antibody (C-Terminus)   

ZBP1 Antibody (C-Terminus)

Rabbit Polyclonal Antibody

     
  • WB - ZBP1 Antibody (C-Terminus) ALS12430
    Western blot of ZBP1 in mouse small intestine tissue lysate with ZBP1 antibody at (A) 0.5, (B) 1...
  • IF - ZBP1 Antibody (C-Terminus) ALS12430
    Immunofluorescence of ZBP1 in Human Small Intestine cells with ZBP1 antibody at 20 ug/ml.
  • IHC - ZBP1 Antibody (C-Terminus) ALS12430
    Anti-ZBP1 antibody IHC of human liver.
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
WB, IHC-P, IF, E
Primary Accession Q9H171
Reactivity Human, Mouse, Rat
Host Rabbit
Clonality Polyclonal
Calculated MW 46kDa
Dilution IHC-P (5 µg/ml), WB (0.5-1 µg/ml),
Additional Information
Other Names Z-DNA-binding protein 1, Tumor stroma and activated macrophage protein DLM-1, ZBP1, C20orf183, DLM1
Reconstitution & Storage Short term 4°C, long term aliquot and store at -20°C, avoid freeze thaw cycles. Store undiluted.
PrecautionsZBP1 Antibody (C-Terminus) is for research use only and not for use in diagnostic or therapeutic procedures.
Protein Information
Name ZBP1
Synonyms C20orf183, DLM1
Function Participates in the detection by the host's innate immune system of DNA from viral, bacterial or even host origin. Plays a role in host defense against tumors and pathogens. Acts as a cytoplasmic DNA sensor which, when activated, induces the recruitment of TBK1 and IRF3 to its C-terminal region and activates the downstream interferon regulatory factor (IRF) and NF-kappa B transcription factors, leading to type-I interferon production. ZBP1-induced NF-kappaB activation probably involves the recruitment of the RHIM containing kinases RIPK1 and RIPK3 (By similarity).
Tissue Location Highly expressed in lymphatic tissues including lymph node, leukocytes, tonsil, bone marrow and spleen Expressed to a lesser extent in thymus, lung and liver EMBL; AJ300575; CAC18810.1; -; mRNA EMBL; CT002036; -; NOT_ANNOTATED_CDS; mRNA EMBL; AK122761; BAG53713.1; -; mRNA EMBL; AL035541; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; CH471077; EAW75511.1; -; Genomic_DNA EMBL; BC028218; AAH28218.1; -; mRNA CCDS; CCDS13461.1; -. [Q9H171-1] CCDS; CCDS54477.1; -. [Q9H171-7] CCDS; CCDS54478.1; -. [Q9H171-6] RefSeq; NP_001153889.1; NM_001160417.1 RefSeq; NP_001153890.1; NM_001160418.1. [Q9H171-7] RefSeq; NP_001153891.1; NM_001160419.2. [Q9H171-6] RefSeq; NP_001310895.1; NM_001323966.1 RefSeq; NP_110403.2; NM_030776.2. [Q9H171-1] UniGene; Hs.302123; - PDB; 2L4M; NMR; -; A=103-166 PDB; 2LNB; NMR; -; A=6-74 PDB; 3EYI; X-ray; 1.45 A; A/B=103-166 PDB; 4KA4; X-ray; 2.60 A; A/B/D/E=96-165 PDBsum; 2L4M; - PDBsum; 2LNB; - PDBsum; 3EYI; - PDBsum; 4KA4; - ProteinModelPortal; Q9H171; - SMR; Q9H171; - BioGrid; 123349; 13 DIP; DIP-44121N; - IntAct; Q9H171; 6 MINT; Q9H171; - STRING; 9606.ENSP00000360215; - iPTMnet; Q9H171; - PhosphoSitePlus; Q9H171; - BioMuta; ZBP1; - DMDM; 71153189; - PaxDb; Q9H171; - PeptideAtlas; Q9H171; - PRIDE; Q9H171; - ProteomicsDB; 80370; - ProteomicsDB; 80371; -. [Q9H171-2] ProteomicsDB; 80372; -. [Q9H171-3] ProteomicsDB; 80373; -. [Q9H171-4] ProteomicsDB; 80374; -. [Q9H171-5] DNASU; 81030; - Ensembl; ENST00000371173; ENSP00000360215; ENSG00000124256. [Q9H171-1] Ensembl; ENST00000395822; ENSP00000379167; ENSG00000124256. [Q9H171-7] Ensembl; ENST00000541799; ENSP00000440552; ENSG00000124256. [Q9H171-6] GeneID; 81030; - KEGG; hsa:81030; - UCSC; uc002xyo.4; human. [Q9H171-1] CTD; 81030; - DisGeNET; 81030; - EuPathDB; HostDB:ENSG00000124256.14; - GeneCards; ZBP1; - H-InvDB; HIX0203057; - HGNC; HGNC:16176; ZBP1 HPA; HPA041256; - MIM; 606750; gene neXtProt; NX_Q9H171; - OpenTargets; ENSG00000124256; - PharmGKB; PA38094; - eggNOG; ENOG410J2S4; Eukaryota eggNOG; ENOG411196S; LUCA GeneTree; ENSGT00390000002234; - HOGENOM; HOG000230878; - HOVERGEN; HBG036279; - InParanoid; Q9H171; - KO; K12965; - OMA; NPDLYAM; - OrthoDB; EOG091G0L53; - PhylomeDB; Q9H171; - TreeFam; TF337658; - Reactome; R-HSA-1606322; ZBP1(DAI) mediated induction of type I IFNs Reactome; R-HSA-1606341; IRF3 mediated activation of type 1 IFN Reactome; R-HSA-1810476; RIP-mediated NFkB activation via ZBP1 Reactome; R-HSA-3134975; Regulation of innate immune responses to cytosolic DNA EvolutionaryTrace; Q9H171; - GeneWiki; ZBP1; - GenomeRNAi; 81030; - PRO; PR:Q9H171; - Proteomes; UP000005640; Chromosome 20 Bgee; ENSG00000124256; - CleanEx; HS_ZBP1; - ExpressionAtlas; Q9H171; baseline and differential Genevisible; Q9H171; HS GO; GO:0005737; C:cytoplasm; IDA:MGI GO; GO:0005829; C:cytosol; IDA:MGI GO; GO:0005634; C:nucleus; IDA:MGI GO; GO:0003677; F:DNA binding; IDA:MGI GO; GO:0003726; F:double-stranded RNA adenosine deaminase activity; IEA:InterPro GO; GO:0042802; F:identical protein binding; IPI:IntAct GO; GO:0003692; F:left-handed Z-DNA binding; NAS:UniProtKB GO; GO:0003723; F:RNA binding; IEA:InterPro GO; GO:0045087; P:innate immune response; IEA:UniProtKB-KW GO; GO:0032481; P:positive regulation of type I interferon production; TAS:Reactome GO; GO:0032479; P:regulation of type I interferon production; TAS:Reactome Gene3D; 1.10.10.10; -; 2 InterPro; IPR000607; dsRNA_A_deaminase InterPro; IPR036388; WH-like_DNA-bd_sf InterPro; IPR036390; WH_DNA-bd_sf Pfam; PF02295; z-alpha; 1 SMART; SM00550; Zalpha; 2 SUPFAM; SSF46785; SSF46785; 2 1: Evidence at protein level; 3D-structure; Alternative splicing; Complete proteome; DNA-binding; Immunity; Innate immunity; Polymorphism; Reference proteome; Repeat CHAIN 1 429 Z-DNA-binding protein 1 /FTId=PRO_0000066564 REPEAT 6 72 DRADA 1 REPEAT 103 168 DRADA 2 MOTIF 195 219 RIP homotypic interaction motif (RHIM) 1 MOTIF 253 277 RIP homotypic interaction motif (RHIM) 2 VAR_SEQ 12 86 Missing (in isoform 7) /FTId=VSP_046081 VAR_SEQ 87 149 AERPQQHAATIPETPGPQFSQQREEDIYRFLKDNGPQRALV IAQALGMRTAKDVNRDLYRMKS -> GNCHPGEAGLTLQGA SWQWTSTDLSLGSNLNSATWELTGFLSLCLGFFFWLMELTA GLLGRGC (in isoform 5) /FTId=VSP_004079 VAR_SEQ 87 109 Missing (in isoform 4). /FTId=VSP_004078 VAR_SEQ 150 429 Missing (in isoform 5) /FTId=VSP_004080 VAR_SEQ 225 248 SAGPRHLPSMAPGDSSTWGTLVDP -> KSPKRAQGGDLGG EPPDPLGGGKG (in isoform 6) {ECO:0000303|Ref.2} /FTId=VSP_045405 VAR_SEQ 249 429 Missing (in isoform 6) {ECO:0000303|Ref.2} /FTId=VSP_045406 VAR_SEQ 365 429 GRRPADTQSRSHFPRDIGQPITPSHSKLTPKLETMTLGNRS HKAAEGSHYVDEASHEGSWWGGGI -> VAAFTEVLNPSKS FMKFGINFFQTPVNVDSLTSSHESQMFLTACRLVIFSRRFS TYFAQIHLRNHSVLHLCPHKIYLLKNKK (in isoform 2). /FTId=VSP_004081 VAR_SEQ 365 429 GRRPADTQSRSHFPRDIGQPITPSHSKLTPKLETMTLGNRS HKAAEGSHYVDEASHEGSWWGGGI -> GRRPADTQSRSFD GQE (in isoform 3). /FTId=VSP_004082 VARIANT 17 17 R -> I (in dbSNP:rs35813125) /FTId=VAR_057030 VARIANT 53 53 K -> R (in dbSNP:rs35895307) /FTId=VAR_061728 VARIANT 70 70 G -> R (in dbSNP:rs34964609) /FTId=VAR_057031 VARIANT 88 88 E -> K (in dbSNP:rs2073145) {ECO:0000269|PubMed:11842111, ECO:0000269|Ref.2} /FTId=VAR_014316 VARIANT 154 154 D -> H (in dbSNP:rs16981187) /FTId=VAR_057032 VARIANT 166 166 R -> H (in dbSNP:rs34478944) /FTId=VAR_057033 VARIANT 258 258 Q -> R (in dbSNP:rs2865394) {ECO:0000269|PubMed:11842111, ECO:0000269|PubMed:14702039, ECO:0000269|Ref.5} /FTId=VAR_069138 VARIANT 332 332 A -> V (in dbSNP:rs41275648) /FTId=VAR_061729 HELIX 10 25 {ECO:0000244|PDB:2LNB} HELIX 31 38 {ECO:0000244|PDB:2LNB} HELIX 42 54 {ECO:0000244|PDB:2LNB} STRAND 57 62 {ECO:0000244|PDB:2LNB} STRAND 65 72 {ECO:0000244|PDB:2LNB} HELIX 108 120 {ECO:0000244|PDB:3EYI} STRAND 122 124 {ECO:0000244|PDB:3EYI} HELIX 125 131 {ECO:0000244|PDB:3EYI} HELIX 137 139 {ECO:0000244|PDB:3EYI} HELIX 141 149 {ECO:0000244|PDB:3EYI} STRAND 152 155 {ECO:0000244|PDB:3EYI} TURN 157 159 {ECO:0000244|PDB:3EYI} STRAND 161 164 {ECO:0000244|PDB:3EYI} SEQUENCE 429 AA; 46343 MW; 2C9B195112822991 CRC64; MAQAPADPGR EGHLEQRILQ VLTEAGSPVK LAQLVKECQA PKRELNQVLY RMKKELKVSL TSPATWCLGG TDPEGEGPAE LALSSPAERP QQHAATIPET PGPQFSQQRE EDIYRFLKDN GPQRALVIAQ ALGMRTAKDV NRDLYRMKSR HLLDMDEQSK AWTIYRPEDS GRRAKSASII YQHNPINMIC QNGPNSWISI ANSEAIQIGH GNIITRQTVS REDGSAGPRH LPSMAPGDSS TWGTLVDPWG PQDIHMEQSI LRRVQLGHSN EMRLHGVPSE GPAHIPPGSP PVSATAAGPE ASFEARIPSP GTHPEGEAAQ RIHMKSCFLE DATIGNSNKM SISPGVAGPG GVAGSGEGEP GEDAGRRPAD TQSRSHFPRD IGQPITPSHS KLTPKLETMT LGNRSHKAAE GSHYVDEASH EGSWWGGGI
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to
info@abgent.com, and receive a free "I Love Antibodies" mug.

Background

Participates in the detection by the host's innate immune system of DNA from viral, bacterial or even host origin. Plays a role in host defense against tumors and pathogens. Acts as a cytoplasmic DNA sensor which, when activated, induces the recruitment of TBK1 and IRF3 to its C-terminal region and activates the downstream interferon regulatory factor (IRF) and NF-kappa B transcription factors, leading to type-I interferon production. ZBP1-induced NF-kappaB activation probably involves the recruitment of the RHIM containing kinases RIPK1 and RIPK3 (By similarity).

References

Rothenburg S.,et al.Nucleic Acids Res. 30:993-1000(2002).
Heil O.,et al.Submitted (JUN-2005) to the EMBL/GenBank/DDBJ databases.
Ota T.,et al.Nat. Genet. 36:40-45(2004).
Deloukas P.,et al.Nature 414:865-871(2001).
Mural R.J.,et al.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases.

FeedBack
Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abgent.com.

$ 425.00
Cat# ALS12430
Size:
Quantity:
Availability: 5 days
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
“Crown Flash”  50 % off on 2,500+ Crown Antibodies. PromoCode:<span class=text-red> FLASH50
Terms & Conditions