Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Cancer   >   ZNF185 Antibody(N-term)   

ZNF185 Antibody(N-term)

Peptide Affinity Purified Rabbit Polyclonal Antibody (Pab)

     
  • WB - ZNF185 Antibody(N-term) AP19670A
    ZNF185 Antibody (N-term) (Cat. #AP19670a) western blot analysis in NCI-H460 cell line lysates (35ug/lane).This demonstrates the ZNF185 antibody detected the ZNF185 protein (arrow).
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
WB, E
Primary Accession O15231
Other Accession NP_001171579.1
Reactivity Human
Host Rabbit
Clonality Polyclonal
Isotype Rabbit Ig
Antigen Region 155-183 aa
Additional Information
Other Names Zinc finger protein 185, LIM domain protein ZNF185, P1-A, ZNF185
Target/Specificity This ZNF185 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 155-183 amino acids from the N-terminal region of human ZNF185.
Dilution WB~~1:1000
Format Purified polyclonal antibody supplied in PBS with 0.09% (W/V) sodium azide. This antibody is purified through a protein A column, followed by peptide affinity purification.
StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
PrecautionsZNF185 Antibody(N-term) is for research use only and not for use in diagnostic or therapeutic procedures.
Protein Information
Name ZNF185
Function May be involved in the regulation of cellular proliferation and/or differentiation.
Cellular Location Cytoplasm, cytoskeleton. Cell junction, focal adhesion
Tissue Location Expressed in placenta, pancreas and kidney. Also expressed in prostate, testis, ovary and blood EMBL; AK095258; BAC04511.1; -; mRNA EMBL; AY997296; AAY54245.1; -; mRNA EMBL; DQ508022; ABF57657.1; -; mRNA EMBL; DQ508023; ABF57658.1; -; mRNA EMBL; DQ508024; ABF57659.1; -; mRNA EMBL; DQ508025; ABF57660.1; -; mRNA EMBL; DQ508026; ABF57661.1; -; mRNA EMBL; Y09538; CAA70733.1; -; mRNA EMBL; AK296967; BAG59511.1; -; mRNA EMBL; AK301530; BAH13507.1; -; mRNA EMBL; U82671; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; CH471172; EAW72895.1; -; Genomic_DNA CCDS; CCDS48184.1; -. [O15231-1] CCDS; CCDS55528.1; -. [O15231-3] CCDS; CCDS55529.1; -. [O15231-6] CCDS; CCDS55530.1; -. [O15231-8] CCDS; CCDS55531.1; -. [O15231-4] CCDS; CCDS55532.1; -. [O15231-5] CCDS; CCDS69832.1; -. [O15231-9] RefSeq; NP_001171577.1; NM_001178106.1. [O15231-6] RefSeq; NP_001171578.1; NM_001178107.1. [O15231-8] RefSeq; NP_001171579.1; NM_001178108.1. [O15231-3] RefSeq; NP_001171580.1; NM_001178109.1. [O15231-7] RefSeq; NP_001171581.1; NM_001178110.1. [O15231-4] RefSeq; NP_001171584.1; NM_001178113.1. [O15231-5] RefSeq; NP_001171586.1; NM_001178115.1. [O15231-9] RefSeq; NP_009081.2; NM_007150.3. [O15231-1] RefSeq; XP_005274788.1; XM_005274731.2. [O15231-6] RefSeq; XP_005274792.1; XM_005274735.2. [O15231-8] RefSeq; XP_005274794.1; XM_005274737.2. [O15231-3] RefSeq; XP_005274795.1; XM_005274738.2. [O15231-1] RefSeq; XP_005274798.1; XM_005274741.2. [O15231-7] RefSeq; XP_005274802.1; XM_005274745.2. [O15231-4] UniGene; Hs.16622; - ProteinModelPortal; O15231; - BioGrid; 113525; 3 IntAct; O15231; 8 iPTMnet; O15231; - PhosphoSitePlus; O15231; - BioMuta; ZNF185; - EPD; O15231; - MaxQB; O15231; - PeptideAtlas; O15231; - PRIDE; O15231; - ProteomicsDB; 48523; - ProteomicsDB; 48524; -. [O15231-2] ProteomicsDB; 48525; -. [O15231-3] ProteomicsDB; 48526; -. [O15231-4] DNASU; 7739; - Ensembl; ENST00000318504; ENSP00000312782; ENSG00000147394. [O15231-4] Ensembl; ENST00000318529; ENSP00000313919; ENSG00000147394. [O15231-5] Ensembl; ENST00000324823; ENSP00000325307; ENSG00000147394. [O15231-2] Ensembl; ENST00000370268; ENSP00000359291; ENSG00000147394. [O15231-1] Ensembl; ENST00000370270; ENSP00000359293; ENSG00000147394. [O15231-6] Ensembl; ENST00000449285; ENSP00000395228; ENSG00000147394. [O15231-3] Ensembl; ENST00000454925; ENSP00000392984; ENSG00000147394. [O15231-9] Ensembl; ENST00000535861; ENSP00000440847; ENSG00000147394. [O15231-6] Ensembl; ENST00000539731; ENSP00000444367; ENSG00000147394. [O15231-8] GeneID; 7739; - KEGG; hsa:7739; - UCSC; uc004fgw.5; human. [O15231-1] CTD; 7739; - DisGeNET; 7739; - EuPathDB; HostDB:ENSG00000147394.18; - GeneCards; ZNF185; - HGNC; HGNC:12976; ZNF185 HPA; HPA000400; - HPA; HPA016438; - MIM; 300381; gene neXtProt; NX_O15231; - OpenTargets; ENSG00000147394; - PharmGKB; PA37558; - GeneTree; ENSGT00530000063872; - HOGENOM; HOG000232182; - HOVERGEN; HBG071794; - InParanoid; O15231; - OMA; EQPHVYI; - OrthoDB; EOG091G09RH; - PhylomeDB; O15231; - TreeFam; TF335114; - ChiTaRS; ZNF185; human GenomeRNAi; 7739; - PRO; PR:O15231; - Proteomes; UP000005640; Chromosome X Bgee; ENSG00000147394; - CleanEx; HS_ZNF185; - ExpressionAtlas; O15231; baseline and differential Genevisible; O15231; HS GO; GO:0015629; C:actin cytoskeleton; IEA:InterPro GO; GO:0005737; C:cytoplasm; IEA:UniProtKB-KW GO; GO:0005925; C:focal adhesion; IEA:UniProtKB-SubCell GO; GO:0051015; F:actin filament binding; IEA:InterPro GO; GO:0008270; F:zinc ion binding; TAS:ProtInc InterPro; IPR030637; ZNF185 InterPro; IPR001781; Znf_LIM PANTHER; PTHR15468:SF2; PTHR15468:SF2; 1 SMART; SM00132; LIM; 1 PROSITE; PS00478; LIM_DOMAIN_1; 1 PROSITE; PS50023; LIM_DOMAIN_2; 1 1: Evidence at protein level; Alternative splicing; Cell junction; Complete proteome; Cytoplasm; Cytoskeleton; LIM domain; Metal-binding; Phosphoprotein; Reference proteome; Zinc CHAIN 1 689 Zinc finger protein 185 /FTId=PRO_0000075911 DOMAIN 627 689 LIM zinc-binding. {ECO:0000255|PROSITE- ProRule:PRU00125} COMPBIAS 159 165 Poly-Glu MOD_RES 153 153 Phosphoserine {ECO:0000250|UniProtKB:Q62394} MOD_RES 447 447 Phosphothreonine MOD_RES 453 453 Phosphoserine MOD_RES 465 465 Phosphoserine VAR_SEQ 1 403 MSISALGGRTKGKPLPPGEEERNNVLKQMKVRTTLKGDKSW ITKQDESEGRTIELPSGRSRATSFSSAGEVPKPRPPSTRAP TGYIIRGVFTKPIDSSSQPQQQFPKANGTPKSAASLVRTAN AGPPRPSSSGYKMTTEDYKKLAPYNIRRSSTSGDTEEEEEE EVVPFSSDEQKRRSEAASGVLRRTAPREHSYVLSAAKKSTG PTQETQAPFIAKRVEVVEEDGPSEKSQDPPALARSTPGSNS ADGGRTKASRAIWIECLPSMPSPAGSQELSSRGEEIVRLQI LTPRAGLRLVAPDVEGMRSSPGNKDKEAPCSRELQRDLAGE EAFRAPNTDAARSSAQLSDGNVGSGATGSRPEGLAAVDIGS ERGSSSATSVSAVPADRKSNSTAAQEDAKADPKG -> MAA RDELGLGGDSLEAMPVPAARGRPRITNGPEELAAPSPA (in isoform 9) /FTId=VSP_054773 VAR_SEQ 1 140 Missing (in isoform 2) /FTId=VSP_039898 VAR_SEQ 1 135 Missing (in isoform 5) /FTId=VSP_045080 VAR_SEQ 141 144 YKKL -> MQRQ (in isoform 2) /FTId=VSP_039899 VAR_SEQ 177 205 RSEAASGVLRRTAPREHSYVLSAAKKSTG -> SS (in isoform 5) /FTId=VSP_045081 VAR_SEQ 205 205 G -> GS (in isoform 2 and isoform 3) /FTId=VSP_039900 VAR_SEQ 246 304 Missing (in isoform 4 and isoform 5) /FTId=VSP_043405 VAR_SEQ 246 275 Missing (in isoform 2) /FTId=VSP_039901 VAR_SEQ 276 304 Missing (in isoform 7 and isoform 8) /FTId=VSP_047205 VAR_SEQ 305 372 Missing (in isoform 2) /FTId=VSP_039902 VAR_SEQ 372 372 G -> GRLCAAASFASFLEDQDGHSANSQSCKPRPAAI (in isoform 6 and isoform 8) /FTId=VSP_047206 CONFLICT 13 13 K -> E (in Ref. 2; ABF57661) CONFLICT 132 132 S -> F (in Ref. 2; ABF57661) CONFLICT 150 150 R -> G (in Ref. 2; ABF57661) CONFLICT 236 236 A -> V (in Ref. 3; BAH13507) CONFLICT 257 257 A -> T (in Ref. 2; ABF57661) CONFLICT 326 326 A -> S (in Ref. 3; BAH13507) CONFLICT 406 406 A -> D (in Ref. 2; ABF57661) CONFLICT 408 408 Y -> C (in Ref. 1; CAA70733) CONFLICT 414 414 A -> P (in Ref. 2; ABF57657/AAY54245 and 1; CAA70733). CONFLICT 488 488 Q -> H (in Ref. 2; ABF57660) CONFLICT 492 492 G -> R (in Ref. 1; CAA70733) CONFLICT 517 517 Q -> R (in Ref. 3; BAC04511) CONFLICT 621 621 S -> F (in Ref. 2; ABF57657/AAY54245) SEQUENCE 689 AA; 73525 MW; 0CCA739701FE1423 CRC64; MSISALGGRT KGKPLPPGEE ERNNVLKQMK VRTTLKGDKS WITKQDESEG RTIELPSGRS RATSFSSAGE VPKPRPPSTR APTGYIIRGV FTKPIDSSSQ PQQQFPKANG TPKSAASLVR TANAGPPRPS SSGYKMTTED YKKLAPYNIR RSSTSGDTEE EEEEEVVPFS SDEQKRRSEA ASGVLRRTAP REHSYVLSAA KKSTGPTQET QAPFIAKRVE VVEEDGPSEK SQDPPALARS TPGSNSADGG RTKASRAIWI ECLPSMPSPA GSQELSSRGE EIVRLQILTP RAGLRLVAPD VEGMRSSPGN KDKEAPCSRE LQRDLAGEEA FRAPNTDAAR SSAQLSDGNV GSGATGSRPE GLAAVDIGSE RGSSSATSVS AVPADRKSNS TAAQEDAKAD PKGALADYEG KDVATRVGEA WQERPGAPRG GQGDPAVPAQ QPADPSTPER QSSPSGSEQL VRRESCGSSV LTDFEGKDVA TKVGEAWQDR PGAPRGGQGD PAVPTQQPAD PSTPEQQNSP SGSEQFVRRE SCTSRVRSPS SCMVTVTVTA TSEQPHIYIP APASELDSSS TTKGILFVKE YVNASEVSSG KPVSARYSNV SSIEDSFAME KKPPCGSTPY SERTTGGICT YCNREIRDCP KITLEHLGIC CHEYCFKCGI CSKPMGDLLD QIFIHRDTIH CGKCYEKLF
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to
info@abgent.com, and receive a free "I Love Antibodies" mug.

Background

Zinc-finger proteins bind nucleic acids and play important roles in various cellular functions, including cell proliferation, differentiation, and apoptosis. This gene encodes a LIM-domain zinc finger protein. The LIM domain is composed of two contiguous zinc finger domains, separated by a two-amino acid residue hydrophobic linker. The LIM domain mediates protein:protein interactions. Multiple alternatively spliced transcript variants encoding different isoforms have been identified.

References

Zhang, J.S., et al. Oncogene 26(1):111-122(2007)
Medina, P.P., et al. Hum. Mol. Genet. 14(7):973-982(2005)
Vanaja, D.K., et al. Cancer Res. 63(14):3877-3882(2003)
Mallon, A.M., et al. Genome Res. 10(6):758-775(2000)
Heiss, N.S., et al. Genomics 43(3):329-338(1997)

FeedBack
Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abgent.com.

$ 295.00
$ 99.00
Cat# AP19670A
Size:
Quantity:
(40 western blots)
Availability: In Stock
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
“Crown Flash”  50 % off on 2,500+ Crown Antibodies. PromoCode:<span class=text-red> FLASH50
Terms & Conditions