Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   RBM14 Antibody (Center)   

RBM14 Antibody (Center)

Purified Rabbit Polyclonal Antibody (Pab)

     
  • WB - RBM14 Antibody (Center) AP2957c
    Western blot analysis of RBM14 Antibody (Center) (Cat. #AP2957c) in Jurkat cell line lysates (35ug/lane). RBM14 (arrow) was detected using the purified Pab.
  • IHC-P - RBM14 Antibody (Center) AP2957c
    Formalin-fixed and paraffin-embedded brain tissue reacted with RBM14 Antibody (Center), which was peroxidase-conjugated to the secondary antibody, followed by DAB staining. This data demonstrates the use of this antibody for immunohistochemistry; clinical relevance has not been evaluated.
  • FC - RBM14 Antibody (Center) AP2957c
    RBM14 Antibody (Center) (Cat. #AP2957c) flow cytometric analysis of Jurkat cells (bottom histogram) compared to a negative control cell (top histogram).FITC-conjugated goat-anti-rabbit secondary antibodies were used for the analysis.
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
FC, WB, IHC-P, E
Primary Accession Q96PK6
Other Accession Q8C2Q3, Q5EA36
Reactivity Human
Predicted Mouse
Host Rabbit
Clonality Polyclonal
Isotype Rabbit Ig
Antigen Region 193-223 aa
Additional Information
Other Names RNA-binding protein 14, Paraspeckle protein 2, PSP2, RNA-binding motif protein 14, RRM-containing coactivator activator/modulator, Synaptotagmin-interacting protein, SYT-interacting protein, RBM14, SIP
Target/Specificity This RBM14 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 193-223 amino acids from the Central region of human RBM14.
Dilution WB~~1:1000
IHC-P~~1:50~100
FC~~1:10~50
Format Purified polyclonal antibody supplied in PBS with 0.09% (W/V) sodium azide. This antibody is prepared by Saturated Ammonium Sulfate (SAS) precipitation followed by dialysis against PBS.
StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
PrecautionsRBM14 Antibody (Center) is for research use only and not for use in diagnostic or therapeutic procedures.
Protein Information
Name RBM14
Synonyms SIP
Function Isoform 1 may function as a nuclear receptor coactivator, enhancing transcription through other coactivators such as NCOA6 and CITED1. Isoform 2, functions as a transcriptional repressor, modulating transcriptional activities of coactivators including isoform 1, NCOA6 and CITED1 (PubMed:11443112). Regulates centriole biogenesis by suppressing the formation of aberrant centriolar protein complexes in the cytoplasm and thus preserving mitotic spindle integrity. Prevents the formation of the STIL-CENPJ complex (which can induce the formation of aberrant centriolar protein complexes) by interfering with the interaction of STIL with CENPJ (PubMed:25385835). Plays a role in the regulation of DNA virus-mediated innate immune response by assembling into the HDP-RNP complex, a complex that serves as a platform for IRF3 phosphorylation and subsequent innate immune response activation through the cGAS-STING pathway (PubMed:28712728).
Cellular Location Nucleus. Nucleus, nucleolus. Cytoplasm. Note=In punctate subnuclear structures often located adjacent to splicing speckles, called paraspeckles (PubMed:11790299). Cytoplasmic localization is crucial for its function in suppressing the formation of aberrant centriolar protein complexes (PubMed:25385835)
Tissue Location Expressed in all tissues tested, including brain, heart, skeletal muscle, colon, thymus, spleen, kidney, liver, small intestine, placenta, lung and peripheral blood lymphocytes EMBL; AF315632; AAK77961.1; -; mRNA EMBL; AF315633; AAK77962.1; -; mRNA EMBL; DQ294957; ABB99396.1; -; mRNA EMBL; EU287938; ABY74511.1; -; mRNA EMBL; AF080561; AAC64058.1; -; mRNA EMBL; AK021768; BAG51046.1; -; mRNA EMBL; AK222830; BAD96550.1; -; mRNA EMBL; AP001157; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; CH471076; EAW74552.1; -; Genomic_DNA EMBL; BC000488; AAH00488.1; -; mRNA EMBL; BE885635; -; NOT_ANNOTATED_CDS; mRNA EMBL; CR749306; CAH18161.1; -; mRNA CCDS; CCDS55772.1; -. [Q96PK6-2] CCDS; CCDS55773.1; -. [Q96PK6-4] CCDS; CCDS8147.1; -. [Q96PK6-1] RefSeq; NP_001185765.1; NM_001198836.1. [Q96PK6-2] RefSeq; NP_001185766.1; NM_001198837.1. [Q96PK6-4] RefSeq; NP_001185774.1; NM_001198845.1. [Q96PK6-5] RefSeq; NP_006319.1; NM_006328.3. [Q96PK6-1] UniGene; Hs.523822; - UniGene; Hs.533712; - PDB; 2DNP; NMR; -; A=77-153 PDBsum; 2DNP; - ProteinModelPortal; Q96PK6; - SMR; Q96PK6; - BioGrid; 115700; 196 BioGrid; 1529298; 34 DIP; DIP-50126N; - IntAct; Q96PK6; 60 MINT; Q96PK6; - STRING; 9606.ENSP00000311747; - iPTMnet; Q96PK6; - PhosphoSitePlus; Q96PK6; - SwissPalm; Q96PK6; - BioMuta; RBM14; - DMDM; 73913750; - EPD; Q96PK6; - MaxQB; Q96PK6; - PaxDb; Q96PK6; - PeptideAtlas; Q96PK6; - PRIDE; Q96PK6; - ProteomicsDB; 77704; - ProteomicsDB; 77705; -. [Q96PK6-2] DNASU; 10432; - Ensembl; ENST00000310137; ENSP00000311747; ENSG00000239306. [Q96PK6-1] Ensembl; ENST00000393979; ENSP00000377548; ENSG00000239306. [Q96PK6-2] Ensembl; ENST00000409738; ENSP00000386995; ENSG00000239306. [Q96PK6-4] GeneID; 100526737; - GeneID; 10432; - KEGG; hsa:100526737; - KEGG; hsa:10432; - UCSC; uc001oit.4; human. [Q96PK6-1] CTD; 100526737; - CTD; 10432; - DisGeNET; 100526737; - DisGeNET; 10432; - EuPathDB; HostDB:ENSG00000239306.4; - GeneCards; RBM14; - HGNC; HGNC:14219; RBM14 HPA; HPA006628; - HPA; HPA047849; - MIM; 612409; gene neXtProt; NX_Q96PK6; - OpenTargets; ENSG00000239306; - OpenTargets; ENSG00000248643; - PharmGKB; PA34263; - eggNOG; ENOG410IES1; Eukaryota eggNOG; ENOG4111RA3; LUCA GeneTree; ENSGT00390000020883; - HOGENOM; HOG000026790; - HOVERGEN; HBG053180; - InParanoid; Q96PK6; - KO; K13189; - OMA; IMSKRYG; - OrthoDB; EOG091G05UU; - PhylomeDB; Q96PK6; - TreeFam; TF320661; - Reactome; R-HSA-8941326; RUNX2 regulates bone development ChiTaRS; RBM14; human EvolutionaryTrace; Q96PK6; - GeneWiki; RBM14; - PRO; PR:Q96PK6; - Proteomes; UP000005640; Chromosome 11 Bgee; ENSG00000239306; - ExpressionAtlas; Q96PK6; baseline and differential Genevisible; Q96PK6; HS GO; GO:0005737; C:cytoplasm; IDA:UniProtKB GO; GO:0016592; C:mediator complex; NAS:UniProtKB GO; GO:0016607; C:nuclear speck; IDA:HPA GO; GO:0005730; C:nucleolus; IEA:UniProtKB-SubCell GO; GO:0005654; C:nucleoplasm; TAS:Reactome GO; GO:0005634; C:nucleus; IDA:UniProtKB GO; GO:1990904; C:ribonucleoprotein complex; TAS:UniProtKB GO; GO:0005667; C:transcription factor complex; IPI:UniProtKB GO; GO:0030374; F:ligand-dependent nuclear receptor transcription coactivator activity; IPI:UniProtKB GO; GO:0030674; F:protein binding, bridging; NAS:UniProtKB GO; GO:0003723; F:RNA binding; HDA:UniProtKB GO; GO:0003712; F:transcription coregulator activity; NAS:UniProtKB GO; GO:0002218; P:activation of innate immune response; IDA:UniProtKB GO; GO:0098534; P:centriole assembly; IMP:UniProtKB GO; GO:0006310; P:DNA recombination; NAS:UniProtKB GO; GO:0006281; P:DNA repair; NAS:UniProtKB GO; GO:0006260; P:DNA replication; NAS:UniProtKB GO; GO:0042921; P:glucocorticoid receptor signaling pathway; NAS:UniProtKB GO; GO:0016575; P:histone deacetylation; IPI:UniProtKB GO; GO:0045087; P:innate immune response; IEA:UniProtKB-KW GO; GO:0030520; P:intracellular estrogen receptor signaling pathway; NAS:UniProtKB GO; GO:0046600; P:negative regulation of centriole replication; IMP:CACAO GO; GO:0045944; P:positive regulation of transcription by RNA polymerase II; IDA:UniProtKB GO; GO:0009725; P:response to hormone; TAS:UniProtKB GO; GO:0060395; P:SMAD protein signal transduction; IEA:Ensembl GO; GO:0006351; P:transcription, DNA-templated; IEA:UniProtKB-KW CDD; cd12608; RRM1_CoAA; 1 CDD; cd12609; RRM2_CoAA; 1 Gene3D; 3.30.70.330; -; 2 InterPro; IPR012677; Nucleotide-bd_a/b_plait_sf InterPro; IPR035979; RBD_domain_sf InterPro; IPR034506; RBM14_RRM1 InterPro; IPR034507; RBM14_RRM2 InterPro; IPR000504; RRM_dom Pfam; PF00076; RRM_1; 2 SMART; SM00360; RRM; 2 SUPFAM; SSF54928; SSF54928; 2 PROSITE; PS50102; RRM; 2 1: Evidence at protein level; 3D-structure; Acetylation; Alternative splicing; Complete proteome; Cytoplasm; Immunity; Innate immunity; Isopeptide bond; Nucleus; Phosphoprotein; Reference proteome; Repeat; Repressor; RNA-binding; Transcription; Transcription regulation; Ubl conjugation CHAIN 1 669 RNA-binding protein 14 /FTId=PRO_0000081774 DOMAIN 1 73 RRM 1. {ECO:0000255|PROSITE- ProRule:PRU00176} DOMAIN 79 149 RRM 2. {ECO:0000255|PROSITE- ProRule:PRU00176} REGION 307 354 TRBP-interacting domain; interaction with STIL. COMPBIAS 224 569 Ala-rich MOD_RES 161 161 Phosphoserine MOD_RES 164 164 N6-acetyllysine; alternate {ECO:0000250|UniProtKB:Q8C2Q3} MOD_RES 206 206 Phosphothreonine MOD_RES 220 220 Phosphoserine MOD_RES 242 242 Phosphoserine MOD_RES 244 244 Phosphoserine MOD_RES 256 256 Phosphoserine MOD_RES 272 272 Phosphoserine MOD_RES 280 280 Phosphoserine MOD_RES 520 520 Phosphoserine MOD_RES 523 523 Phosphoserine MOD_RES 527 527 Phosphoserine MOD_RES 562 562 Phosphoserine MOD_RES 572 572 Phosphothreonine MOD_RES 582 582 Phosphoserine MOD_RES 618 618 Phosphoserine MOD_RES 620 620 Phosphoserine MOD_RES 623 623 Phosphoserine MOD_RES 627 627 Phosphoserine MOD_RES 643 643 Phosphoserine MOD_RES 649 649 Phosphoserine CROSSLNK 126 126 Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) CROSSLNK 135 135 Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) CROSSLNK 138 138 Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) CROSSLNK 149 149 Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) CROSSLNK 153 153 Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) CROSSLNK 164 164 Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate. CROSSLNK 600 600 Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) VAR_SEQ 112 339 KDYAFVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKGQK KGPGLAVQSGDKTKKPGAGDTAFPGTGGFSATFDYQQAFGN STGGFDGQARQPTPPFFGRDRSPLRRSPPRASYVAPLTAQP ATYRAQPSVSLGAAYRAQPSASLGVGYRTQPMTAQAASYRA QPSVSLGAPYRGQLASPSSQSAAASSLGPYGGAQPSASALS SYGGQAAAASSLNSYGAQGSSLA -> KGKRMHVQLSTSRL RTAPGMGDQSGCYRCGKEGHWSKECPIDRSGRVADLTEQYN EQYGAVRTPYTMSYGDSLYYNNAYGALDAYYKRCRAARSYE AVAAAAASVYNYAEQTLSQLPQVQNTAMASHLTSTSLDPYD RHLLPTSGAAATAAAAAAAAAAVTAASTSYYGRDRSPLRRA TAPVPTVGEGYGYGHESELSQASAAARNSLYDMARYEREQY ADRARYSAF (in isoform 5) /FTId=VSP_047494 VAR_SEQ 113 119 DYAFVHM -> GMVPTGV (in isoform 4) /FTId=VSP_047109 VAR_SEQ 113 118 DYAFVH -> GGMCVG (in isoform 3) /FTId=VSP_044641 VAR_SEQ 119 669 Missing (in isoform 3) /FTId=VSP_044642 VAR_SEQ 120 669 Missing (in isoform 4). /FTId=VSP_047110 VAR_SEQ 151 156 QKKGPG -> MVPTGV (in isoform 2) /FTId=VSP_015078 VAR_SEQ 157 669 Missing (in isoform 2) /FTId=VSP_015079 VAR_SEQ 340 669 Missing (in isoform 5) /FTId=VSP_047495 CONFLICT 560 560 S -> T (in Ref. 1; AAK77961) CONFLICT 609 609 A -> V (in Ref. 6; BAD96550) STRAND 81 85 {ECO:0000244|PDB:2DNP} HELIX 92 102 {ECO:0000244|PDB:2DNP} STRAND 105 110 {ECO:0000244|PDB:2DNP} STRAND 115 120 {ECO:0000244|PDB:2DNP} HELIX 122 132 {ECO:0000244|PDB:2DNP} STRAND 143 147 {ECO:0000244|PDB:2DNP} SEQUENCE 669 AA; 69492 MW; 565C5EF51B6881FD CRC64; MKIFVGNVDG ADTTPEELAA LFAPYGTVMS CAVMKQFAFV HMRENAGALR AIEALHGHEL RPGRALVVEM SRPRPLNTWK IFVGNVSAAC TSQELRSLFE RRGRVIECDV VKDYAFVHME KEADAKAAIA QLNGKEVKGK RINVELSTKG QKKGPGLAVQ SGDKTKKPGA GDTAFPGTGG FSATFDYQQA FGNSTGGFDG QARQPTPPFF GRDRSPLRRS PPRASYVAPL TAQPATYRAQ PSVSLGAAYR AQPSASLGVG YRTQPMTAQA ASYRAQPSVS LGAPYRGQLA SPSSQSAAAS SLGPYGGAQP SASALSSYGG QAAAASSLNS YGAQGSSLAS YGNQPSSYGA QAASSYGVRA AASSYNTQGA ASSLGSYGAQ AASYGAQSAA SSLAYGAQAA SYNAQPSASY NAQSAPYAAQ QAASYSSQPA AYVAQPATAA AYASQPAAYA AQATTPMAGS YGAQPVVQTQ LNSYGAQASM GLSGSYGAQS AAAATGSYGA AAAYGAQPSA TLAAPYRTQS SASLAASYAA QQHPQAAASY RGQPGNAYDG AGQPSAAYLS MSQGAVANAN STPPPYERTR LSPPRASYDD PYKKAVAMSK RYGSDRRLAE LSDYRRLSES QLSFRRSPTK SSLDYRRLPD AHSDYARYSG SYNDYLRAAQ MHSGYQRRM
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to
info@abgent.com, and receive a free "I Love Antibodies" mug.

Background

Isoform 1 may function as a nuclear receptor coactivator, enhancing transcription through other coactivators such as NCOA6 and CITED1. Isoform 2, functions as a transcriptional repressor, modulating transcriptional activities of coactivators including isoform 1, NCOA6 and CITED1.

References

Andersen,J.S., et.al., Curr. Biol. 12 (1), 1-11 (2002)
Brett,D., et.al., Hum. Mol. Genet. 6 (9), 1559-1564 (1997)

FeedBack
Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abgent.com.

$ 295.00
$ 99.00
Cat# AP2957c
Size:
Quantity:
(40 western blots)
Availability: In Stock
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
“Crown Flash”  50 % off on 2,500+ Crown Antibodies. PromoCode:<span class=text-red> FLASH50
Terms & Conditions